(data stored in ACNUC7421 zone)

EMBL: CP001630.PE150

CP001630.PE150       Location/Qualifiers
FT   CDS_pept        complement(166576..168750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SAMD1; sterile alpha motif domain containing
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34124"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34124.1"
FT                   /translation="MSARTGELLGVDLEDCFVFQNGRLYPCEVWSRARIGVASRAHDAA
FT                   SGKPVEWSRRFRGEVEPLFRLGVVRLTGNGPEPVPDADLHAGLLAGDADERLVLVRRPD
FT                   VPYPDVPEVADTPVLPQALAEAEAAVLAGAPEGWRELVLGCRFFRAQAEFRAEVVLADG
FT                   STRSWTPPALAAQWLHRLRMTDHRTAWDWRFAPGAEVVREGRSEPPAPERPGNNRCELI
FT                   GPVGVFDGHAPRWYRPPVGEAELEAVLGYLRGAPVVLEGDGFVEDLVAEQTGGSRETEV
FT                   PLTHHTDGVLTWTSAVAYFLERHGVPPHPALVRRMRERDYAVGGVSEFGLRRGEVFAGD
FT                   DLAPGFREGRTAWASLQKALAPVRGFLEAHGLALEDTESTGWVVEVAPYDGYLVKPHGS
FT                   ATGEEFDSAEHAAMYLLGRLCAELGAPAAPAAAAVPPPAAPPLPAQHSQPLPVQHPRSQ
FT                   PLPVQQAQPVQQSLPLPVPPPGPQTPPPWQAQPLAPQDGQWRPGPHTVTTSNGPTHPKH
FT                   PGMPPVTPELLAAQRANRQPYVRCVDPAVNHPRFAGAVPDWAVYGAYLTNPATGELTGE
FT                   AVLNSEYRPSPRHLGLPEPRTELEAVLGLVTAGWLPSASAGDAALRAKLFVVMRGPDEL
FT                   PVIVSTTGARLMEVYTTRDRFLEGVQRTMDGRPQDHVGVFDEKLLVEVDAHSLLPSIHN
FT                   VVLVVNPRTGLTTRVAGSALIAAANRPVFR"
     gtgagtgcgc ggactgggga actgctgggc gtcgacctgg aggactgctt cgtcttccag        60
     aacggtcggc tctacccgtg cgaggtgtgg agccgggcgc ggatcggcgt cgcgagccgg       120
     gcgcacgacg ccgcctccgg caagccggtc gagtggtcgc gcaggttccg gggcgaggtc       180
     gagccgctgt tccggctggg cgtggtgcgg ctgaccggga acgggccgga gccggtgccg       240
     gacgccgacc tgcacgcggg cctgctcgcc ggggacgcgg acgagcggct ggtgctggtg       300
     cgccgccccg acgtgcccta cccggacgtg cccgaggtgg cggacacccc ggtgctgccg       360
     caggcgctcg ccgaggccga ggccgccgtg ctcgcgggcg cccccgaggg gtggcgggag       420
     ctggtgctgg gctgccggtt cttccgcgcg caggccgagt tccgggccga ggtcgtgctg       480
     gcggacggga gcacgcggtc gtggacgccg cccgcgctgg cggcccagtg gctgcaccgg       540
     ttgcggatga ccgaccaccg cacggcgtgg gactggcggt tcgcccccgg cgccgaggtg       600
     gtcagggagg ggcggtccga gccgcccgcg cccgagcggc cgggcaacaa ccggtgcgag       660
     ctgatcggcc cggtcggcgt gttcgacggg cacgcgccgc gctggtaccg gcccccggtg       720
     ggcgaggccg agctggaggc ggtgctcggg tacctgcgcg gcgcgccggt ggtgctggag       780
     ggcgacgggt tcgtggagga cctggtcgcc gagcagaccg gcgggtcgcg ggagaccgag       840
     gtgccgctga cgcaccacac ggacggcgtg ctcacctgga cgagcgcggt ggcgtacttc       900
     ctggagcggc acggggtccc gccgcacccg gcgctggtgc ggcggatgcg cgagcgcgac       960
     tacgcggtgg gcggggtgtc cgagttcggg ttgcgccggg gcgaggtgtt cgcgggcgac      1020
     gacctggcgc cggggttccg ggaggggcgg acggcgtggg cgagcctgca gaaggcgctg      1080
     gcgccggtgc gggggttcct ggaggcgcac gggctggcgc tggaggacac cgagtcgacc      1140
     gggtgggtgg tcgaggtggc gccgtacgac gggtacctgg tgaagccgca cgggtcggcg      1200
     acgggcgagg agttcgacag cgcggagcac gcggcgatgt acctgctggg gaggttgtgc      1260
     gcggagctgg gggcgcccgc cgccccggcg gcggctgcgg tcccgccgcc cgccgccccg      1320
     ccgctgcccg cgcagcactc gcagccgctc ccggtgcagc acccgcgctc gcagcctctg      1380
     ccggtgcagc aggcccagcc cgtgcagcag tcgctcccgc tgcccgtgcc gccgcccggc      1440
     ccgcagaccc cgccgccgtg gcaggcccag cccctggcgc cccaggacgg ccagtggcgg      1500
     cccggcccgc acacggtgac caccagcaac ggcccgacgc acccgaagca tccggggatg      1560
     ccgccggtca cgccggagct gctggccgcg cagcgcgcca accggcagcc gtacgtgcgc      1620
     tgcgtcgacc cggcggtgaa ccacccgcgc ttcgcgggcg ccgtgccgga ctgggcggtg      1680
     tacggcgcgt acctgaccaa cccggcgacc ggcgagctga ccggtgaggc ggtgctgaac      1740
     agcgagtacc gcccgagccc ccggcacctg ggcctcccgg agccgaggac ggagctggag      1800
     gcggtgctgg gcctggtcac ggcgggctgg ctgcccagcg cgtcggccgg tgacgcggcg      1860
     ctgcgcgcga agctgttcgt ggtgatgcgc ggccccgacg agctgccggt catcgtgagc      1920
     acgacgggcg cgcggctgat ggaggtctac acgaccaggg accggttcct ggagggcgtg      1980
     cagcgcacga tggacggcag gccgcaggac cacgtcgggg tgttcgacga gaagctgctg      2040
     gtggaggtcg acgcgcacag cctgctgccg tcgatccaca acgtggtgct ggtggtgaac      2100
     ccccgcaccg gcctcaccac gcgggtggcg ggcagcgccc tgatcgcggc ggcgaaccgc      2160
     ccggtgttcc gctga                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page