(data stored in ACNUC7421 zone)

EMBL: CP001630.PE151

CP001630.PE151       Location/Qualifiers
FT   CDS_pept        complement(168872..169687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0154"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sml:Smlt3132 putative
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34125"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY0"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU34125.1"
FT                   /translation="MESLRAVSQWPVDSAAVAAVSSDGRVLGSHGDLERRYPLASVTKL
FT                   LTSYAVLVAVEEGAVEWDDPAGPEGSTVRHLIAHTSGLAFDSDKVQAAPGERRIYSNRG
FT                   FEVLADAVERSSGIAFGDYLAEAVLGPLGMGSTALEGSPAAGGVSTVADLVAFAAEVQS
FT                   PKLVSAGLVAEARTVAFPGLKGVLPGYGLQRENDWGLGFEIRSAKSPHWTGTTSSPGTH
FT                   GHFGQSGTFLWFDPALSAACVALTDRPFGEWAVAAWTPFTDSVVAELAR"
     gtggagagct tgcgcgcggt gtcgcagtgg ccggtggaca gcgcggcggt ggccgcggtc        60
     tcctcggacg gccgggtcct ggggtcgcac ggggacctgg agcggcgcta cccgctggcc       120
     tcggtgacca agctgctcac ctcgtacgcg gtgctggtcg cggtggagga gggcgccgtc       180
     gagtgggacg acccggcggg ccccgagggg tccacggtgc ggcacctgat cgcgcacacc       240
     tccgggctgg cgttcgactc cgacaaggtc caggccgccc ccggcgagcg ccggatctac       300
     tccaaccggg gcttcgaggt gctcgcggac gccgtggagc ggtcgagcgg catcgcgttc       360
     ggggactacc tggccgaggc ggtgctcggc ccgctcggca tggggtcgac ggcgctggag       420
     ggctcccccg ccgcgggcgg ggtgtcgacg gtggcggacc tggtggcgtt cgcggcggag       480
     gtgcagtcgc cgaagctggt gtcggccggg ctcgtcgccg aggccaggac cgtggcgttc       540
     cccggtctga agggcgtgct gcccggttac gggctccagc gcgagaacga ctgggggctg       600
     ggcttcgaga tccggtcggc caagtcgccg cactggaccg gcacgaccag ctcccccggc       660
     acgcacgggc acttcgggca gagcggcacg ttcctgtggt tcgacccggc cctgtcggcg       720
     gcgtgcgtgg cgctgaccga ccggccgttc ggcgagtggg ccgtcgccgc gtggaccccg       780
     ttcacggact cggtcgtggc ggaactggcc cgttag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page