(data stored in ACNUC7421 zone)

EMBL: CP001630.PE152

CP001630.PE152       Location/Qualifiers
FT   CDS_pept        169787..171295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0155"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: bur:Bcep18194_A5663 DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34126"
FT                   /db_xref="GOA:C6WDY1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY1"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACU34126.1"
FT                   /translation="MSRKSFPLVVVVVALAASTPALTASAAPSDCPAGTEGVPITWDEP
FT                   GLEWPANVVDAQVEDVGGTDLDVAVVLSDPASRNADDSNPLADFAAARPADLPGWAAIP
FT                   RTGTLSSYGPGYLTAGMNSLAVGDTVSYTVRFTRPVVVPDFTVGGIDHTGLGTVPARDP
FT                   WHSHQDEVVVTAVRAGTAVATSGTGTGLGGPYALGVDGTLPPGDPRATLVRGTAEPVTA
FT                   LRLDLSNGPDDEAAELADPRATVLPQPANSVADAVTVRVAGFTACLGTGAITSSVYADA
FT                   DRDGVRDPGEAGVAGAALELRDPQGSVLATTTADASGGYAFDRLPPMAWTVRLVSATPP
FT                   ATYTGPTSRTVALTPGEQATAAGDFAFQPPAPQPAATTTTAPPTTTAPTTTPPTTAPPT
FT                   TTAGPISSSPTTTAPTAPTTTAPAAGPITARPAPPSAQAQALASTGADVRALAPLGALL
FT                   VALGGLAVGASRRRARRAPGRAPVRPARTAPGGLAVSATRRRTR"
     ttgtcccgca agtcgttccc gctggtggtg gtcgtcgtgg cgctggccgc gtccaccccc        60
     gcgctgaccg cctccgccgc gccgtccgac tgcccggcgg gcaccgaggg cgtgccgatc       120
     acctgggacg aacccggcct ggagtggccc gcgaacgtgg tggacgccca ggtcgaggac       180
     gtcggcggca ccgacctgga cgtggccgtg gtgctgtccg acccggcctc ccgcaacgcc       240
     gacgacagca acccgctggc cgacttcgcc gccgcgcgcc ccgccgacct gccgggctgg       300
     gcggccatcc cgaggaccgg caccctgtcg agctacggcc ccggctacct gacggcgggc       360
     atgaacagcc tggcggtggg cgacaccgtc tcgtacaccg tccgcttcac ccgcccggtc       420
     gtcgtcccgg acttcaccgt cgggggcatc gaccacaccg ggctggggac cgtcccggcc       480
     agggacccgt ggcactcgca ccaggacgag gtcgtggtga ccgccgtccg cgcgggcacc       540
     gccgtcgcca ccagcggcac gggcaccggg ctgggcggcc cgtacgcgct cggcgtcgac       600
     gggaccctcc cgcccggcga tccgcgcgcg accctggtgc gcggcaccgc ggagccggtc       660
     accgcgctgc gcctggatct ctccaacggc cccgacgacg aggccgccga gctggccgac       720
     ccgagggcca ccgtgctccc gcagcccgcg aactcggtgg cggacgccgt gaccgtgcgc       780
     gtcgcgggct tcaccgcgtg cctgggcacc ggcgcgatca cgtcctcggt gtacgcggac       840
     gccgaccggg acggcgtgcg cgaccccggc gaggcgggtg tcgcgggggc ggcgctggag       900
     ctgcgcgacc cgcagggctc ggtgctggcc accacgaccg cggacgcctc gggcggctac       960
     gccttcgacc ggctgccgcc gatggcctgg acggtccggc tggtgtcggc gaccccgccc      1020
     gccacctaca ccgggccgac cagccgcacc gtcgcgctga cgccggggga gcaggccacc      1080
     gcggcgggcg acttcgcgtt ccagccgccc gcgccgcagc ccgcggcgac caccacgacc      1140
     gccccgccca cgaccacggc gcccacgacc accccgccca cgaccgcccc gcccacgacg      1200
     accgccggac cgatcagctc gtcccccacg accaccgccc cgaccgcgcc caccacgacc      1260
     gcgcccgccg cagggccgat caccgcccgg cccgcgcccc cgtccgccca ggcgcaggcg      1320
     ctcgcgtcca ccggggccga cgtccgcgcg ctggccccgc tcggcgcgct cctcgtcgcc      1380
     ctcggcggcc tggcggtcgg cgcgtcgcgg cggcgcgctc gccgagctcc cggtcgcgcg      1440
     ccggtccgac cggccaggac cgccccaggt ggactcgcgg tcagcgcgac ccggcggcgg      1500
     actcgctga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page