(data stored in ACNUC7421 zone)

EMBL: CP001630.PE153

CP001630.PE153       Location/Qualifiers
FT   CDS_pept        complement(171267..172106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0156"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: hha:Hhal_0769 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34127"
FT                   /db_xref="GOA:C6WDY2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACU34127.1"
FT                   /translation="MSPMRVLVTGARGYVGRAVAAELSGAGCEVVPLGCDVRSPEARDA
FT                   ARSVDAVVHLAALARVRESFERPLDYFDVNVAGTANLLRAEPARFVLASTAGVYGAPGV
FT                   PVLSEDVPRAPASPYAASKAAAEDLVRWAAPGGVVLRLFNVAGGGDRDDTRIVTRACAA
FT                   ASGRLGPLAVYGDGGAVRDFVHVRDAARAFLVALGLDGGVFNVGATAASVADVVAAVEQ
FT                   VAGRPPAVEHHPAHPGEVRELRSDSARLRAAGWAPERSGLVELVRDQWLSESAAGSR"
     atgtcgccca tgcgggtatt ggtcacgggc gcacggggtt atgtcggccg cgcggtggcg        60
     gcggagttgt ccggagcggg gtgcgaggtg gtcccgctgg ggtgcgacgt gcgctccccc       120
     gaggcgcggg acgcggcgcg gtcggtcgac gcggtggtgc acctggccgc gctggcgcgg       180
     gtgcgcgagt cgttcgagcg gccactggac tacttcgacg tgaacgtggc gggcaccgcg       240
     aacctgctgc gcgccgaacc cgcccggttc gtgctcgcct ccacggccgg ggtgtacggc       300
     gcgccgggcg tcccggtgct gtccgaggac gtgccgcgcg cgcccgcgag tccttacgcc       360
     gcctcgaagg ccgccgccga ggacctggtg cgctgggccg cgccgggcgg ggtggtgctg       420
     cggctgttca acgtcgcggg cggcggcgac cgggacgaca cgcggatcgt caccagggcg       480
     tgcgcggcgg cgtccgggcg gctcgggccg ctggcggtgt acggcgacgg cggcgcggtg       540
     cgggacttcg tgcacgtgcg ggacgcggcg cgggcgttcc tggtcgcgct cggactggac       600
     ggcggggtgt tcaacgtggg cgcgacggcg gcgagcgtgg ccgacgtggt ggccgccgtg       660
     gagcaggtcg ccgggcgacc gccggccgtc gagcaccacc cggcgcaccc cggcgaggtg       720
     cgggagctgc ggtcggactc ggcgcggctg cgcgcggccg ggtgggctcc ggagcggtcc       780
     gggctggtcg agctggtgcg cgaccagtgg ctcagcgagt ccgccgccgg gtcgcgctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page