(data stored in ACNUC7421 zone)

EMBL: CP001630.PE155

CP001630.PE155       Location/Qualifiers
FT   CDS_pept        172593..174020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34129"
FT                   /db_xref="GOA:C6WDY4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34129.1"
FT                   /translation="MDHVLLALQERLGTLFGDRRVVLAGGTRLSNRVNELHQLGARHTL
FT                   VLSTDDHAPLHDSERARWVPLGIGGFVATEQNRLTKLLTSPGRRVRAVLDEFDPEGEAL
FT                   VISTPYSQVPSFAGRPVLSARRPEWVELENKTTVDALWDELSAPRAPAEVLGLDFDALW
FT                   EATLRLDRGAGAVWSGDGPAINGGANFVRRVRDREEARDAFEVLAPKCDFVRVMPFLEG
FT                   IPVSVHGIVFPDGTAVLRPIEMVVPRRAGSARFLYAGCASYYDPPARIREQMRNLARRV
FT                   GERLRETVDYRGTFTLDGIATADGFLPTEINTRYGGAMVCFEDALPQLPLSLVQVALVA
FT                   GHDLGVSSMEFEELLVSAADAYRHGSVGANARAVRPTETVERPIVFSEWACRFAHPDET
FT                   PHGALRLKPSPLGGKLELDFTADQLQLGRPVAALTVAAFALADQEWGTGFGPLEPAVPI
FT                   ADDEQPAQVVEQVFVTA"
     atggatcatg tcctcctcgc gctccaggag cgcctcggca ccttgttcgg cgaccggcgg        60
     gttgtcctcg ccgggggcac gcggctgagc aatcgcgtga acgagctgca ccagctcggc       120
     gcgcgccaca cgctcgtgct gtcgacggac gaccacgccc ccctgcacga ctccgaacgc       180
     gcccgctggg tgccgctcgg catcggcggc ttcgtcgcga ccgagcagaa ccggctcacc       240
     aagctgctca cctcgccggg caggcgcgtc cgcgccgtgc tcgacgagtt cgaccccgag       300
     ggcgaagccc tggtgatcag caccccctac tcccaggtgc cctcgttcgc gggccgcccg       360
     gtcctcagcg cgcgccgccc cgagtgggtg gagctggaga acaagaccac cgtcgacgcg       420
     ctgtgggacg agctgtccgc gccgcgcgcc cccgccgagg tgctcgggct cgacttcgac       480
     gccctgtggg aggccacgct ccggctcgac cggggcgcgg gcgcggtgtg gtccggcgac       540
     ggcccggcga tcaacggcgg cgcgaacttc gtgcgccgcg tccgcgaccg cgaggaggcc       600
     cgcgacgcct tcgaggtgct cgcgcccaag tgcgacttcg tccgcgtgat gccgttcctg       660
     gagggcatcc cggtcagcgt gcacggcatc gtcttcccgg acggcaccgc cgtgctgcgc       720
     ccgatcgaga tggtcgtgcc gcgccgcgcc gggtccgccc ggttcctcta cgcgggctgc       780
     gcgtcctact acgacccgcc cgcccgcatc cgcgagcaga tgcgcaacct ggcccgccgg       840
     gtcggcgagc ggctgcgcga gaccgtggac taccggggca cgttcaccct ggacggcatc       900
     gccaccgccg acggcttcct gcccaccgag atcaacaccc ggtacggcgg cgccatggtg       960
     tgcttcgagg acgccctgcc gcagctgccg ctctcgctcg tccaggtggc gctggtggcc      1020
     gggcacgacc tcggggtgtc ctcgatggag ttcgaggagc tgctcgtctc ggccgccgac      1080
     gcctaccggc acgggtcggt cggcgcgaac gcgcgcgctg tgcggcccac cgagaccgtc      1140
     gagcggccca tcgtgttctc cgagtgggcc tgccgcttcg cgcaccccga cgagaccccg      1200
     cacggcgcgc tgcgcctcaa gccgtccccg ctgggcggca agctggagct cgacttcacc      1260
     gccgaccagc tccagctcgg ccgcccggtg gccgcgctga ccgtcgccgc gttcgcgctc      1320
     gccgaccagg agtggggcac cggcttcggc ccgctggagc ccgccgtccc gatcgccgac      1380
     gacgagcagc ccgcccaggt cgtggagcag gtgttcgtca cggcgtga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page