(data stored in ACNUC7421 zone)

EMBL: CP001630.PE156

CP001630.PE156       Location/Qualifiers
FT   CDS_pept        complement(174010..174810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34130"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34130.1"
FT                   /translation="MELPAAWWRPDPLRGVEDVPWRALSGGLGVDDLLRGAAEGEPGAC
FT                   DGLAARLLDEDTVSEATVRAVPFLVELGAGYKVPADTRDRVIFLLAAIALAGAGFTEGG
FT                   TRRTRRRWNRLGRELPRRQPDLMTQARQAVALGAPKVFDSLGLAEVACSMALAIAVPEV
FT                   APQHVVDVAHGIAFAGSFPEPLQESAVVALHLVHGWECDESWVYAIAQGDPELLRAYEE
FT                   GAFPPYQPSAVTLQLLGFRYAFLAAYGQEGVLGMDLLGGAPVTP"
     atggaactgc ccgcggcctg gtggcggccg gaccccctgc gcggggtgga ggacgtgccg        60
     tggcgcgcgc tctccggcgg cctcggcgtc gacgacctgc tgaggggcgc cgccgagggc       120
     gagccgggcg cgtgcgacgg gctcgccgcg cggctgctgg acgaggacac ggtgtccgag       180
     gcgacggtgc gcgcggtgcc gttcctggtg gagctggggg ccggttacaa ggtccccgcg       240
     gacacccgcg atcgggtgat attcctgctg gccgcgatcg cgctcgcggg cgcgggcttc       300
     accgagggcg ggacgcggcg cacccgcagg cggtggaacc ggctggggcg ggagctgccc       360
     cggcggcagc cggacctgat gacgcaggcg cggcaggcgg tcgccctggg cgcgccgaag       420
     gtgttcgact cgctgggcct ggccgaggtg gcctgctcga tggcgctggc gatcgccgtg       480
     cccgaggtgg cgccgcagca cgtggtggac gtggcgcacg gcatcgcgtt cgcgggctcg       540
     ttccccgagc cgctgcagga gtcggcggtg gtggcgctgc acctggtgca cggctgggag       600
     tgcgacgagt cctgggtgta cgcgatagcg cagggcgacc cggagctgct gcgcgcctac       660
     gaggagggcg ccttcccgcc ctaccagccg tcggcggtca cgttgcagct gctcggcttc       720
     cggtacgcct tcctggccgc gtacggccag gaaggcgtgc tcgggatgga cctgctcggg       780
     ggcgcgccgg tcacgccgtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page