(data stored in ACNUC7421 zone)

EMBL: CP001630.PE157

CP001630.PE157       Location/Qualifiers
FT   CDS_pept        174893..176107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0160"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   nmc:NMC1992 modification methylase (cytosine- specific DNA
FT                   methylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34131"
FT                   /db_xref="GOA:C6WDY6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY6"
FT                   /inference="protein motif:PRIAM:2.1.1.37"
FT                   /protein_id="ACU34131.1"
FT                   /translation="MRGPTYKVVDLFSGAGGMSLGFRTHRDFTVVGAADAQIGKPSSPL
FT                   GSLRCNNVYRDNIGIDPLQVDLGRIDPAVLREVWGLRRGELDVLVACPPCSGFTRITAA
FT                   NHLRDDPRNSLVGRVARFVAELRPKVLLMENARELVRGKQRHHLDGLAEQLIALGYEVD
FT                   ASSHMLSRFGLPQLRERAVVVAVDAGIPLRTLEDVWRGREVRPAAVTVRRAIGKLPPIP
FT                   AGYAHPDDAMHVSPSFRADRSLDRMRAIPVDGGSWADLVGAPDTELLLNPAQVKIIEAG
FT                   RWGSHPDVYGRMWWDEPARTIKRECAHVGNGRYAHPEQHRLCTVREMALLQGFPRKFRF
FT                   DVSVLGNAYRHLGDAVPPLISYQLASLVRWMLSGERPTARELCLPGTSLRPSDIRPALV
FT                   PSLVA"
     gtgcgcggac ccacctacaa ggttgtcgac ctgttctccg gcgcgggtgg gatgagcctc        60
     gggttccgaa cccaccgcga cttcaccgtc gtcggcgcgg cggacgcgca gatcggcaag       120
     ccctcgtccc cgctgggctc gctgcggtgc aacaacgtct accgcgacaa catcggcatc       180
     gacccgctgc aggtcgacct cggccggatc gacccggcgg tgctgcgcga ggtgtggggg       240
     ctgcggcgcg gcgagctgga cgtgctggtg gcctgcccgc cgtgctccgg cttcacccgg       300
     atcaccgccg ccaaccacct gcgcgacgac ccgcgcaact cgctggtcgg ccgggtggcc       360
     cggttcgtgg ccgagctgcg ccccaaggtg ctgctgatgg agaacgcgcg cgagctggtg       420
     cgcggcaagc agcggcacca cctggacggg ctggccgagc agctgatcgc gctcggctac       480
     gaggtggacg cctcctcgca catgctgtcc cggttcggcc tgccgcagct gcgcgagcgg       540
     gccgtcgtgg tggcggtgga cgcgggcatc cccctgcgga cgctggagga cgtgtggcgc       600
     ggccgggagg tgcgtcccgc cgccgtgacg gtgcggcgcg ccatcggcaa gctgccgccc       660
     atcccggcgg gctacgcgca cccggacgac gccatgcacg tctccccgtc gttccgggcg       720
     gaccgctcgc tggaccggat gcgggcgatc ccggtggacg gcggctcgtg ggcggacctc       780
     gtcggcgcgc cggacaccga gctgctgctg aaccccgccc aggtgaagat catcgaggcc       840
     ggccggtggg gttcgcaccc ggacgtctac gggcggatgt ggtgggacga gcccgcgcgg       900
     acgatcaaac gggaatgcgc gcacgtcgga aatggtcgct atgcgcatcc ggagcagcac       960
     cgcttgtgca ccgtgcgtga gatggcgctt ctccagggat tcccccggaa gttccgattc      1020
     gacgtctccg tgctggggaa cgcgtaccgg cacctgggcg acgcggtgcc gccgctgatc      1080
     tcctaccagc tcgcctcgct ggtgcgctgg atgctttccg gagagcgccc caccgcccgt      1140
     gaactgtgcc ttcccggcac gtccctgcgt ccgagcgaca tccgacccgc gctggttccg      1200
     agcctggtcg cttga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page