(data stored in ACNUC7421 zone)

EMBL: CP001630.PE158

CP001630.PE158       Location/Qualifiers
FT   CDS_pept        176495..177745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0161"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: ADR019Cp; K01066 esterase / lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34132"
FT                   /db_xref="GOA:C6WDY7"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY7"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACU34132.1"
FT                   /translation="MASRLLKRAGAIALGASIALTTAALPASATAIEILPIPRHDPDFA
FT                   KFHEEGIEVKMSGHKDKDNWLGANLIALKVKEDGKTTGVKAYCVELPTPLENGTPLTEV
FT                   PWGEHPNSGTKFKENADKINWILQNSYPVKDASVLSEATGKSVSKREAIAATQAAIWHF
FT                   SDGADLDTTKDRDRQTNEDVKAVYAYLIGEKNVGIKEQPAPSLAITPKTQSGKPGDLIG
FT                   PFEVSTTAGAVVLKADLPQGVTLVDAAGATLKTAAKGDASASADTKFEKVFVKVPEGAK
FT                   DGQVSFSLQADAKLNSGRLFVSSDKNKKTQSLVVALPSQVTVKAEATASWKAEQVTTPP
FT                   TTTSVSTSPSAPAPSSSNPSTPESSTPETSVSPVPVAEKDELASTGASIFVPLLIGLGL
FT                   LGAGAAAMIVMRRRKTA"
     atggcatccc ggttgttgaa gcgtgctggg gcaatcgccc tcggtgcttc gatcgcgctg        60
     accaccgccg ccctgcccgc ttccgcgacg gccatcgaga tcctcccgat cccgaggcac       120
     gatcccgact tcgcgaagtt ccacgaagag ggcatcgagg tcaagatgtc cggtcacaag       180
     gacaaggaca actggctcgg cgccaacctc atcgcgctga aggtcaagga agacggcaag       240
     accaccggcg tcaaggcgta ctgcgtcgag ctgccgaccc cgctggagaa cggcactccg       300
     ctgaccgagg tcccgtgggg cgagcacccc aattcgggca ccaagttcaa ggagaacgcc       360
     gacaagatca actggattct ccagaacagc tacccggtca aggacgcctc cgtcctgagc       420
     gaggcgaccg gcaagtcggt cagcaagcgc gaggccatcg ccgccaccca ggccgcgatc       480
     tggcacttca gcgacggcgc cgacctggac accaccaagg accgggaccg ccagaccaac       540
     gaggacgtca aggcggtcta cgcctacctg atcggcgaga agaacgtcgg catcaaggag       600
     cagcccgctc cctcgctggc gatcaccccg aagacgcagt cgggcaagcc gggcgacctg       660
     atcggcccgt tcgaggtcag caccaccgcg ggcgccgtcg tcctcaaggc cgacctgccc       720
     cagggcgtga ccctggtcga cgccgcgggc gcgaccctga agaccgccgc caagggcgac       780
     gcgtcggcct ccgccgacac caagttcgag aaggtcttcg tcaaggtccc cgagggcgcc       840
     aaggacggcc aggtctcctt ctcgctgcag gccgacgcga agctgaacag cggtcgcctc       900
     ttcgtcagca gcgacaagaa caagaagacc cagtcgctcg tcgtcgcgct gccgagccag       960
     gtgacggtca aggccgaggc caccgccagc tggaaggccg agcaggtcac cacgccgccg      1020
     accaccacct cggtgagcac ctccccgagc gccccggccc cgagcagcag caacccgagc      1080
     acgccggagt cctccacccc ggagacctcg gtcagcccgg tccccgtggc cgagaaggac      1140
     gagctcgcct ccaccggcgc ctcgatcttc gtgccgctgc tgatcggcct cggcctgctg      1200
     ggcgcgggcg ccgccgcgat gatcgtgatg cgtcgccgca agaccgcgtg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page