(data stored in ACNUC7421 zone)

EMBL: CP001630.PE159

CP001630.PE159       Location/Qualifiers
FT   CDS_pept        177884..178057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34133"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34133.1"
FT                   /translation="MNFDEIKNKATQLLEQHHETVEKGIDQAADFISDRLGHQEQVHSA
FT                   AEKAKDALPGAR"
     gtgaacttcg acgagatcaa gaacaaggcg acgcagctgc tggagcagca ccacgagacg        60
     gtcgagaagg gcatcgacca ggcggcggac ttcatctcgg accggctcgg gcaccaggag       120
     caggtccact cggcggccga gaaggccaag gacgccctgc cgggtgcgcg gtga             174
//

If you have problems or comments...

PBIL Back to PBIL home page