(data stored in ACNUC7421 zone)

EMBL: CP001630.PE16

CP001630.PE16        Location/Qualifiers
FT   CDS_pept        complement(17118..17384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0016"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33990"
FT                   /db_xref="GOA:C6WCG9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG9"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACU33990.1"
FT                   /translation="MPKSKVRKKAVYTAPADRRTPVKVKAAGPSHPFYITVMLGVMLLG
FT                   LAWLVVNYIAGEKIPVMMDLGSWNFGIGFSLIIVGLLMTMRWR"
     atgcccaagt ccaaggtccg caagaaggcc gtctacacgg cgcctgccga tcgacgcacc        60
     ccggtgaagg tcaaggcagc aggtccttcg cacccgttct acatcacggt gatgctgggt       120
     gtcatgctgc tcggcctcgc ctggttggtg gtcaactaca tcgccggcga gaagatcccg       180
     gtgatgatgg acctcgggtc gtggaacttc ggcatcggct tctcgctgat catcgtcggc       240
     ctgctgatga cgatgcgctg gcgctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page