(data stored in ACNUC7421 zone)

EMBL: CP001630.PE160

CP001630.PE160       Location/Qualifiers
FT   CDS_pept        178054..178677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0163"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   sme:SMc03980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34134"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY9"
FT                   /inference="protein motif:PFAM:PF06475"
FT                   /protein_id="ACU34134.1"
FT                   /translation="MSTARTAERATAQQGESRAAARMVTWQGCSVPRLEQVRVLVSEHK
FT                   LRASGRIVASGPAEQFNGSFELSVGEDGAVTRLLLRTATVAEERHVSLSRSSDGVWMVD
FT                   RGHGGERADFDGAVDVDVEFAVLFAAIPVRRLGLHREPGEAELPVVRVSLPDLDVTVVR
FT                   RGYRTASVGDGGSVVAIRAEDGEQDVTVDAEGLVVDYPDVAQRI"
     gtgagcaccg ccaggacggc cgagcgcgcc accgcccagc agggcgagtc ccgcgccgcc        60
     gctcgcatgg tcacctggca ggggtgctcg gtgcccaggc tggagcaggt ccgcgtgctg       120
     gtgtccgagc acaagctcag ggcgtccggc cggatcgtcg cctcggggcc cgccgagcag       180
     ttcaacggct ccttcgagct gtcggtcggc gaggacggcg ccgtgacgcg gctgctgctg       240
     cgcaccgcca ccgtcgccga ggagcggcac gtctcgctca gccggtcctc cgacggcgtc       300
     tggatggtcg accggggcca cggcggtgag cgggccgact tcgacggcgc ggtcgacgtg       360
     gacgtggagt tcgcggtgct gttcgcggcc atcccggtcc ggcggctggg cctgcaccgg       420
     gagcccggtg aggccgagct gcccgtggtg cgggtcagcc tgcccgacct ggacgtcacc       480
     gtcgtgcggc gcggctaccg caccgcgtcg gtcggcgacg gcggctcggt cgtggcgatc       540
     cgcgcggagg acggcgagca ggacgtcacc gtggacgccg aggggctggt cgtggactac       600
     ccggacgtgg cgcaaaggat ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page