(data stored in ACNUC7421 zone)

EMBL: CP001630.PE161

CP001630.PE161       Location/Qualifiers
FT   CDS_pept        complement(178764..179948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0164"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: gbm:Gbem_1434 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34135"
FT                   /db_xref="GOA:C6WDZ0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACU34135.1"
FT                   /translation="MQRPLILDAARTPFGRYRGGLSGVRVDDLAALPISELLRRHPDLD
FT                   PARVDDVLYGNTNGAGEENRNIGRMAALLAGLPPTVPGASVNRLCASGGEAIVQASRAL
FT                   AMGDADVVVAGGVEGMTRAPFVVPRPDRPFADRLEPVSTALGWRLVNPRMPSAWTVPLG
FT                   RAAEQVAAELGITRERMDQYALRSHRRASAAWDAGVHDGFAFPVQLPDGSAVRRDESVR
FT                   PETSAEKLAKLKPAFSDDGTVTAGNSSPLNDGAAAVLLGTESLATELGVTPLGEVLGSA
FT                   VTAGEPQRFTLAPVGAIRKLLGRLGIGGADVDLWEINEAFAAMALSVLHHLPEVDREKV
FT                   NVHGGAIAYGHPLGASMPRVVVDLCRHLRARGGGVGVAAACVGVGQGMAIAVRV"
     atgcagcgcc cactgatcct cgacgccgcc cgcacgccgt tcggccgtta ccggggcggg        60
     ctctccggtg tccgggtcga cgacctggcc gccctgccga tctccgagct gctgcgcagg       120
     cacccggacc tggacccggc gcgcgtcgac gacgtgctgt acgggaacac gaacggggcc       180
     ggtgaggaga accggaacat cgggcggatg gccgcgctgc tggcgggcct gccgccgacg       240
     gtgccgggcg cctcggtgaa ccggctgtgc gcgtccggcg gcgaggcgat cgtgcaggcc       300
     tcgcgggcgc tcgcgatggg tgacgcggac gtggtcgtgg cgggcggggt ggagggcatg       360
     acccgcgcgc cgttcgtggt gccgaggccg gaccggccgt tcgcggaccg gctggagccg       420
     gtgtccacgg cgctgggctg gcggctggtg aacccgagga tgccgtccgc gtggacggtc       480
     ccgctggggc gggccgccga gcaggtggcc gccgagctgg gcatcacccg cgagcggatg       540
     gaccagtacg cgctgcgctc gcaccggcgg gcgtcggcgg cgtgggacgc gggcgtgcac       600
     gacgggttcg cgttcccggt gcagctgccg gacgggtcgg cggtgcgcag ggacgagtcg       660
     gtgcggccgg agacgagcgc ggagaagctg gcgaagctca agcccgcgtt cagcgacgac       720
     ggcacggtga cggcgggcaa ctcctcgccg ctgaacgacg gcgcggcggc ggtcctgctg       780
     ggcaccgagt cgctggccac cgagctgggc gtcaccccgc tgggcgaggt gctggggtcg       840
     gcggtcacgg cgggcgagcc gcagcggttc accctggcgc cggtgggggc gatccggaag       900
     ctgctggggc ggctggggat cggcggcgcg gacgtggacc tgtgggagat caacgaggcg       960
     ttcgcggcga tggcgctgtc ggtgctgcac cacctgcccg aggtggaccg ggagaaggtg      1020
     aacgtgcacg gcggggcgat cgcctacggg cacccgctgg gggcgtcgat gccgagggtc      1080
     gtggtggacc tgtgcaggca cctgcgggcg cgcggcggcg gcgtgggcgt cgcggcggcg      1140
     tgcgtggggg tcgggcaggg catggcgatc gcggtgcggg tctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page