(data stored in ACNUC7421 zone)

EMBL: CP001630.PE162

CP001630.PE162       Location/Qualifiers
FT   CDS_pept        complement(179961..181772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG32656"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34136"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34136.1"
FT                   /translation="MDRRRIGFFAAGAVLFAGVVVVLRGGGAPGPADAGITTQPPPPTS
FT                   LTAFASDGVLAPSPGSVPDPPEGLEAAPGPGSLVVTWTGGAPGYEVRWGLGDVSRTRLV
FT                   TGSLVELRLADGLEQRVEVRAVDGFGQRSAPASVSGAPGPVGVSEPGAYHLVDRFEGAS
FT                   APDPARWRLTARPGCARAGAGSDEEAAALVVATTCAGVPAVLRSRAPLVLREDGEELGR
FT                   FAVGAGAPIANGELALELAPGPVAALSGAEPPPGALRLLVRATEDSVTARVLTAEGDRT
FT                   RELRPLDGVAPGTGHVWELVLRRDGALVLLDGEPVATSPVVPAWREATALISVSGPIGQ
FT                   RVPVWLAGLGGAPSTAPPLVGPVRVEVTPQGGEAGSGVGAPAGQLRLTVSHTLSRERDA
FT                   PLVALVSGVPVPLRRAVDGAPVRADTGLPLVGDVPAGVASVSPDGVVGVRLDLGFDATA
FT                   THAELELGPGGAVPVAANPEPGPPQSALPRPSARVLDASGRPLPPGTPVPRGRVVVEVE
FT                   LVGAPAQHGLAGLAGFGLWLDGTRIASVPTAVGGPAVAGTYRVAVNTGALPGGPLSEGP
FT                   HMVEARLFGTSGSTRPTSAFASFFAAR"
     gtggaccgtc gcaggatcgg tttcttcgcc gcgggcgcgg tgctgttcgc gggtgtggtc        60
     gtcgtgctgc gcgggggcgg cgcccccggt ccggcggacg ccgggatcac cacgcagcca       120
     ccgccgccga cctcgctgac ggcgttcgcc tcggacgggg tgctcgcacc ctcccccggc       180
     tcggtcccgg acccgcctga ggggctggag gccgcgccgg gaccgggcag cctggtcgtg       240
     acctggaccg gcggggcccc cggctacgag gtgcgctggg gcctcggcga cgtgtcgcgc       300
     acccggctgg tgaccgggtc gctggtggag ctgcggctgg ccgacgggct ggagcagcgg       360
     gtcgaggtgc gcgcggtgga cgggttcggc cagcgctccg cgcccgcgtc ggtctccggc       420
     gcgccggggc cggtcggggt gtccgagccg ggcgcctacc acctggtgga ccggttcgag       480
     ggggcgtccg cgcccgatcc ggcgcgctgg cggctcaccg ccaggcccgg ctgcgcgcgg       540
     gcgggcgcgg gctcggacga ggaggctgcg gcgctggtcg tggccaccac ctgcgcgggc       600
     gtgcccgccg tgctgcgctc gcgcgcgccg ctggtgctgc gcgaggacgg ggaggagctg       660
     gggcggttcg cggtgggcgc gggcgcgccg atcgcgaacg gcgagctggc gctggagctg       720
     gcgcccggcc cggtggccgc gctgtccggg gccgagccgc cgccgggggc gctgcggctg       780
     ctggtgcggg ccaccgagga ctcggtgacc gcgcgggtgc tgaccgccga gggcgaccgg       840
     acgcgggagc tgcgcccgct ggacggcgtc gcgccgggca ccgggcacgt gtgggagctg       900
     gtgctgcgcc gggacggggc gctggtgctg ctggacggcg agccggtggc caccagcccg       960
     gtcgtgcccg cgtggcggga ggcgaccgcg ctgatctcgg tgtccgggcc gatcgggcag      1020
     cgggtcccgg tgtggctggc cgggctgggc ggcgcgccgt ccaccgctcc cccgctggtg      1080
     gggccggtgc gggtggaggt gacgccgcag ggcggcgagg ccgggtcggg ggtgggcgcg      1140
     cccgccgggc agctgcggct gacggtgtcg cacaccctgt cccgcgagcg cgacgcgccg      1200
     ctggtggccc tggtgtccgg ggtgccggtg ccgctgcggc gcgccgtcga cggggccccg      1260
     gtccgggcgg acaccggcct cccgctggtg ggggacgtgc ccgccggggt ggcctcggtg      1320
     tcgcccgacg gggtggtcgg ggtgcggctg gacctggggt tcgacgccac cgcgacgcac      1380
     gccgagctgg agctggggcc gggcggggcg gtgcccgtcg cggccaaccc cgaaccgggg      1440
     ccgccgcaga gcgcgctgcc ccggccgtcc gcgcgggtgc tggacgcgtc gggccgcccg      1500
     ctgccgccgg gcacgccggt gccgcgcggc cgggtggtgg tcgaggtgga gctggtgggc      1560
     gcgcccgccc agcacgggct ggccgggctc gccgggttcg ggctgtggct ggacgggacg      1620
     cggatcgcct cggtgcccac ggcggtcggg gggcccgcgg tggccgggac ctaccgggtg      1680
     gcggtgaaca ccggggcgct gccgggcggg ccgctctcgg agggcccgca catggtggag      1740
     gcgcggctgt tcggcacttc ggggtccacg cggcccacct cggctttcgc ctcgttcttc      1800
     gccgctcggt ga                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page