(data stored in ACNUC7421 zone)

EMBL: CP001630.PE163

CP001630.PE163       Location/Qualifiers
FT   CDS_pept        complement(181830..182186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34137"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34137.1"
FT                   /translation="MTGGEVGAPVLDSWSPPLPATPPVRTRFARDGDRVRLVVSLLDPL
FT                   ARELLPLRELRVDLDGERLAVVPLGGSVGGVHEFEVSGVEPGGHRVRVEVEPEQLDLAT
FT                   TVRETEVTQSLPPR"
     gtgaccggcg gggaggtcgg ggcgcccgtc ctggactcct ggtcgcctcc cctccccgcg        60
     acgcccccgg tgcggacgcg gttcgcccgc gacggcgacc gggtgcgcct ggtggtgtcg       120
     ctgctggacc cgctggcgcg cgagctgctg ccgctgcggg agctgcgggt ggacctggac       180
     ggcgagcggc tcgcggtggt gccgctgggc ggctcggtcg gcggggtgca cgagttcgag       240
     gtgtccgggg tggagcccgg cgggcaccgg gtgcgggtcg aggtggagcc ggagcagctg       300
     gacctcgcga ccacggtgcg ggagaccgaa gtcacccagt cgctgccgcc ccgctag          357
//

If you have problems or comments...

PBIL Back to PBIL home page