(data stored in ACNUC7421 zone)

EMBL: CP001630.PE165

CP001630.PE165       Location/Qualifiers
FT   CDS_pept        complement(183317..184273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0168"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: gsu:GSU2607
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34139"
FT                   /db_xref="GOA:C6WDZ4"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ4"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACU34139.1"
FT                   /translation="MRELCVVGLGLIGGSVLRAAVAAGWTAWGATASEEDAGTARADGF
FT                   DVVDLVEALARAQRSDALVVLAVPLPAVERVLRMLPAGVRLTDVVSVKGPVADLVGRCA
FT                   PSARYVGGHPMAGTSASGWAASDVALFRGAAWVVAAEDGCDLDVLGDVVRLALAVGAHV
FT                   VPTDADEHDVAVARVSHLPHVLAAVLASVGAEGGPLALALAAGSFGDATRVAGSDPDLV
FT                   RAMCEGNRNALLGAVDDALGRLGAARGSLASTGGLAKTIDAGHAARGRLDALRADEGAE
FT                   VTVDLAARDAREALRAVGARGGRVVALDGTTALARTF"
     gtgcgtgagc tgtgcgtggt cgggttgggg ttgatcggcg gttcggtgct gcgggcggcg        60
     gtggccgccg ggtggaccgc ctggggcgcc acggcgtccg aggaggacgc cgggacggcg       120
     cgcgccgacg ggttcgacgt ggtcgacctg gtcgaggcgc tggcccgcgc ccagcgctcg       180
     gacgccttgg tggtgctggc ggtgccgctg cccgccgtgg agcgggtgct gcggatgctg       240
     cccgccgggg tgcggctgac cgacgtggtg agcgtgaagg gcccggtggc cgacctggtg       300
     ggccgctgcg cgccgtcggc ccggtacgtg ggcgggcacc cgatggcggg cacctccgcg       360
     tcgggctggg cggcgagcga cgtggcgctg ttccggggcg cggcgtgggt ggtggcggcc       420
     gaggacgggt gcgacctgga cgtgctgggc gacgtggtgc ggctggcgct ggcggtgggc       480
     gcgcacgtgg tgccgaccga cgcggacgag cacgacgtgg cggtggcgcg ggtgtcgcac       540
     ctgccgcacg tgctggcggc ggtgctggcc agcgtgggcg cggagggcgg gccgctggcg       600
     ctggcgctgg ccgccgggtc gttcggcgac gcgacgcggg tggcgggcag cgacccggac       660
     ctggtgcgcg cgatgtgcga gggcaaccgg aacgcgctgc tgggcgcggt ggacgacgcg       720
     ctgggccggt tgggcgcggc gcgcgggtcg ctggcgtcca cgggcgggct ggcgaagacg       780
     atcgacgccg ggcacgcggc gcgcgggcgg ttggacgcgc tgcgcgcgga cgagggcgcc       840
     gaggtgaccg tggacctggc cgcgcgggac gcccgcgagg cgctgcgcgc ggtgggcgcg       900
     cgcggtgggc gcgtggtggc gctggacggc acgaccgcgc tggcgaggac cttctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page