(data stored in ACNUC7421 zone)

EMBL: CP001630.PE166

CP001630.PE166       Location/Qualifiers
FT   CDS_pept        complement(184371..185606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0169"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: sal:Sala_2314 peptidase M20D, amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerization domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34140"
FT                   /db_xref="GOA:C6WDZ5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ5"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACU34140.1"
FT                   /translation="MSTPAPSPSEHTEDPRFTGLSEEARALQPRTVALRRQVHRHPEQG
FT                   LDLPRTQAAVLHALEGLPLEITTGTTSSSVVAVLRGERPGPTVLLRGDMDALPVQEETG
FT                   LDYASEVPGAMHACGHDAHVAMLASAARLLSGRRDALAGQVLFMFQPGEEGHHGARFML
FT                   EEGLLDAAGARPVKALALHVSATVASGVVLTRPGPMMASADTFRVLVRGRGGHGGMPHD
FT                   ALDPVPAAAAMVGALQTMVARRVSVHRPAVVTVGRIEAGTTNNVIPETALLEGTIRTLS
FT                   EETRTLVHRELVAVCEHVAAAHGCAAEVEVTPGYPVTVNDAEVAPRLLELASTVLGPRW
FT                   VAEAEDPLMGAEDFSYVLREVPGAMAFLGACPRGVDLARAEPNHSGRALFDEAALEHGV
FT                   VVYSAFALDALR"
     atgagcacac ccgcgcccag cccgtccgag cacaccgagg acccgcgctt caccggcctg        60
     tccgaggagg cccgcgcgct ccagccgcga accgtggcgc tgcgcaggca ggtgcaccgg       120
     caccccgagc aggggctgga cctgccgagg acgcaggccg cggtgctgca cgcgctggag       180
     ggcctgccgc tggagatcac caccggcacg acctcgtcct cggtggtggc ggtgctgcgc       240
     ggggagcggc cggggccgac ggtgctgctg cgcggggaca tggacgcgct gcccgtgcag       300
     gaggagaccg ggctggacta cgcctccgag gtgccgggcg ccatgcacgc gtgcgggcac       360
     gacgcgcacg tggcgatgct cgcctcggcc gcccggctgc tgtcgggcag gcgggacgcg       420
     ctggcgggcc aggtcctgtt catgttccag cccggcgagg agggccacca cggggcccgg       480
     ttcatgctgg aggagggcct gctcgacgcg gcgggggcgc ggccggtgaa ggcgctggcg       540
     ctgcacgtgt cggcgacggt cgcctccggc gtggtgctga cccggccggg gccgatgatg       600
     gcctcggcgg acaccttccg ggtgctcgtg cgcgggcgcg gcgggcacgg cgggatgccg       660
     cacgacgcgc tcgacccggt gcccgcggcg gcggcgatgg tgggcgcgct ccagaccatg       720
     gtggcccggc gggtcagcgt gcaccggccc gcggtggtga cggtgggccg gatcgaggcg       780
     ggcaccacga acaacgtcat cccggagacc gccctgctgg agggcacgat ccggaccctg       840
     tccgaggaga cccggaccct ggtccaccgg gagctggtgg cggtgtgcga gcacgtcgcc       900
     gccgcgcacg gctgcgccgc cgaggtggag gtgacgcccg gctacccggt cacggtcaac       960
     gacgccgagg tcgcgccgcg gctgctggag ctggcgtcga ccgtgctggg cccgcgctgg      1020
     gtcgccgagg ccgaggaccc gctgatgggc gccgaggact tctcctacgt gctgcgcgag      1080
     gtgccgggcg ccatggcgtt cctgggggcc tgcccgcgcg gggtggacct ggcgcgcgcc      1140
     gagccgaacc actcgggccg ggccctgttc gacgaggccg cgctggagca cggggtggtg      1200
     gtctacagcg cgttcgcgct ggacgccctg cggtga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page