(data stored in ACNUC7421 zone)

EMBL: CP001630.PE167

CP001630.PE167       Location/Qualifiers
FT   CDS_pept        185647..186177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34141"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34141.1"
FT                   /translation="MLPGEGRWPYGVHMPEQEPPVHGFAVAVVREDNRWRCSTLDGDAL
FT                   SELDAAITQLRGLRSTGAVFGLLAVDDEFFIVLRPVPGGVSLLLSDAAAALDYDIAADV
FT                   LDLLRVDPPDEEDEELWPEGDLAVLADLGMPKHELQVIVDEVDLYPDEQLQMIAQRIGF
FT                   GEEFTRLLDTLQA"
     gtgctaccgg gtgagggccg gtggccctac ggtgtgcaca tgcctgagca ggagccgccg        60
     gtgcacggct tcgcggtcgc ggtcgtccgg gaggacaacc gctggcggtg cagcaccctg       120
     gacggcgacg cgctgtcgga gttggacgcg gcgatcaccc agttgcgggg gctgcgctcc       180
     acgggcgcgg tgttcgggct cctggcggtg gacgacgagt tcttcatcgt gctgcgcccg       240
     gtgccgggcg gggtgtcgct gctgctgtcc gacgcggcgg cggccctgga ctacgacatc       300
     gccgccgacg tgctggacct gctgcgcgtc gaccctcccg acgaggagga cgaggagctg       360
     tggcccgagg gcgacctcgc ggtcctggcg gacctgggga tgccgaagca cgagctgcag       420
     gtgatcgtcg acgaggtcga cctgtacccg gacgagcagc tgcagatgat cgcccagcgg       480
     atcggcttcg gcgaggagtt cacccgcctg ctggacaccc tccaggcgtg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page