(data stored in ACNUC7421 zone)

EMBL: CP001630.PE168

CP001630.PE168       Location/Qualifiers
FT   CDS_pept        186174..186656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0171"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gur:Gura_0055 CMP/dCMP deaminase, zinc- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34142"
FT                   /db_xref="GOA:C6WDZ7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ7"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACU34142.1"
FT                   /translation="MITAPYDAMVGAALEAAAGAGEDIPIGAAVFGPDGAELARACNAR
FT                   ERLGDPTAHAEVLALRAAAAVFGDGWRLGGCTLAVTVEPCAMCAGALVLARVDRVVFGA
FT                   WEPKTGAAGSLWDVVRDRRLNHRAEVVGGVREAECAALMRDFFAGRDTSERWPESG"
     gtgatcaccg cgccgtacga cgcgatggtc ggcgccgccc tggaggcggc ggcgggcgcg        60
     ggcgaggaca tcccgatcgg cgcggcggtc ttcggcccgg acggcgcgga gctggcgcgg       120
     gcctgcaacg cgcgcgagcg cctgggcgac ccgaccgcgc acgccgaggt cctggccctg       180
     cgcgcggcgg cggcggtctt cggcgacggc tggcggctgg gcggctgcac cctggcggtg       240
     acggtcgagc cgtgcgcgat gtgcgcgggc gccctggtgc tggcgcgggt ggaccgcgtg       300
     gtgttcggcg cgtgggagcc gaagacgggc gcggcgggct ccctgtggga cgtggtccgc       360
     gaccgcaggc tcaaccaccg ggccgaggtg gtcggcgggg tccgcgaggc cgagtgcgcg       420
     gcgctgatgc gggacttctt cgcaggtcgg gacacgtccg aacggtggcc ggagagcggc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page