(data stored in ACNUC7421 zone)

EMBL: CP001630.PE169

CP001630.PE169       Location/Qualifiers
FT   CDS_pept        complement(186876..188189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0172"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sus:Acid_5994
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34143"
FT                   /db_xref="GOA:C6WDZ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACU34143.1"
FT                   /translation="MPREKKGRSANGRSSIYYSETDQSWHGWVTVGTKDNGQSDRRHVR
FT                   GKNQDEVSDKVSKLERMRDQGRVTKAGQNWTVETWLKHWLENIVAPPVVSENAYSAYEV
FT                   AVRVHLVPGIGAHRLVKLQPEHLEKLYRAIMRKSTKFGPTTSSSTAHQVHRTIRAALNV
FT                   AVRRKHLTENPALEARAPKLEETEVEPYSVDQVKALLVTALKRRNSARWAIALALGLRQ
FT                   GEALGLRWQDVDLEVGTLVVRRNRLRPKWRHGCTEPCGKKHGGYCPQRVALREETAGTK
FT                   SAAGKRGMGLPDELVRLLRVHRDVQARERERAAELWTDTGYVFTTPTGGPLNPRSDYDE
FT                   WKRLLDIAKVPDGRLHDARHTAATVLLLLGVPERTVMGIMGWSNTAMAARYQHVTAAIR
FT                   LDVAQRVGGLLWEPAEKPTEPRDEGEEGDATGALIPTA"
     atgccgcgcg agaaaaaggg ccggagtgcc aacggccggt ccagcatcta ctacagcgag        60
     acggaccaga gctggcacgg ctgggtcacg gtcggcacga aggacaacgg ccagtccgac       120
     cgcaggcacg tccgggggaa gaaccaggac gaggtctcgg acaaggtgag caagctggag       180
     cggatgcgcg accagggacg ggtgacaaaa gccgggcaga actggaccgt ggaaacctgg       240
     ctgaagcact ggctggagaa catcgtggct ccgccggtcg tctccgagaa cgcgtacagc       300
     gcgtacgaag tggcggtgcg ggtgcacctg gtgcccggta tcggcgctca tcggctggtg       360
     aagttgcagc cggagcacct ggagaagctg taccgggcga tcatgcggaa gagcacgaag       420
     ttcggtccaa ccaccagctc ttccaccgcg caccaggtgc accggacgat ccgggccgcg       480
     ctgaacgtcg cggttcggcg caagcacctg accgagaacc cggcgttgga ggcgcgggcg       540
     cccaagctgg aggagaccga ggtcgagccg tactcggtcg accaggtcaa ggctctgctg       600
     gtgacggcgc tcaagcggcg gaacagcgcg cggtgggcga tcgcgctggc gctcggactg       660
     cgccagggtg aagcgctcgg actgcggtgg caggacgtgg acttggaggt ggggacgctc       720
     gtggtccgcc gcaaccggct gcggccgaag tggaggcacg ggtgcaccga gccttgcggc       780
     aagaagcacg gcgggtactg cccacagcgg gtggcgttgc gggaggagac cgctgggacg       840
     aagtcggctg cgggcaagcg cgggatgggt ctgcccgacg agctggtgag gctgctcagg       900
     gtgcaccggg acgtgcaggc gcgggagcgt gagcgggccg ctgagctgtg gacggacacg       960
     gggtacgtct tcaccacccc gaccggtggg ccgctcaacc cgaggtcgga ctacgacgag      1020
     tggaagcggc tgctggacat cgccaaggtc ccggacggac ggctgcacga cgcccggcac      1080
     accgcagcga ccgtgctcct gctgctgggc gttcccgagc ggaccgtcat ggggatcatg      1140
     ggctggtcca acaccgcgat ggccgcgcgc taccagcacg tcaccgcagc gatccggctg      1200
     gacgtggctc agcgggtcgg aggattgctc tgggagcccg ctgagaagcc cactgagccc      1260
     cgcgatgagg gcgaggaggg tgatgccacc ggagcgctta tcccgaccgc ctga            1314
//

If you have problems or comments...

PBIL Back to PBIL home page