(data stored in ACNUC7421 zone)

EMBL: CP001630.PE17

CP001630.PE17        Location/Qualifiers
FT   CDS_pept        17775..18836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0017"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: sus:Acid_5377 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33991"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH0"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU33991.1"
FT                   /translation="MLRPVGDAPTQYAQPVGRSLPPPPGRPVAPPRHRAPRRPVEPPTE
FT                   VIPRFEDDRDDYEDPQDDLDRDDLDRDDLDRDERAGADRHEPEYPPEGPLRKVVRGTGE
FT                   ALITLGLVVLLFVVYEVYVTDLISAGKQDDVTSALDEEWKDSNTVAADPQREVKYDLLD
FT                   GKAFAKIYIPVFGADYKFSIVEGTTDKDLETGPGHYKGTALPGEKGNFAVAGHRVGKGS
FT                   PFNDLDLLSSCDAIVVETQASWFVYRMLPKNSEVAGWASRASDPRCKDVAPLSGPYSKT
FT                   QGQEIVLPSAGEVINEVPYNEAQVPEDQLKSLMTLTTCHPRFSDKQRLIVHATLAQHYP
FT                   KSDGFLPPELKEQ"
     gtgctgcggc cggtcggcga cgcgcccacg cagtacgcgc agcccgtcgg gcgcagcctg        60
     cccccgccgc cgggacggcc cgtcgcgccg ccgcgccacc gcgcgccgcg caggcccgtc       120
     gagcctccca cggaggtcat ccccaggttc gaggacgacc gggacgacta cgaggacccg       180
     caggacgacc tcgaccggga cgacctcgac cgggacgacc tcgaccggga cgagcgcgcc       240
     ggggcggacc ggcacgagcc ggagtacccg cccgagggcc cgctgcgcaa ggtcgtgcgg       300
     ggcaccggcg aggcgctgat cacgctcggc ctcgtcgtgc tgctgttcgt ggtctacgag       360
     gtctacgtca ccgacctgat ctccgcgggc aagcaggacg acgtcacctc ggcgctggac       420
     gaggagtgga aggactcgaa caccgtcgcg gccgacccgc agcgcgaggt caagtacgac       480
     ctgctcgacg gcaaggcgtt cgcgaagatc tacatcccgg tgttcggggc ggactacaag       540
     ttctccatcg tcgagggcac caccgacaag gacctggaga ccggccccgg ccactacaag       600
     ggcaccgccc tgccggggga gaagggcaac ttcgcggtcg cgggccaccg ggtcggcaag       660
     ggctcgccgt tcaacgacct cgacctgctc agctcgtgcg acgcgatcgt ggtggagacc       720
     caggcgtcct ggttcgtcta ccggatgctg ccgaagaaca gcgaggtcgc ggggtgggcc       780
     tcccgcgcgt ccgaccccag gtgcaaggac gtcgcgccgc tcagcgggcc gtactccaag       840
     acccagggcc aggagatcgt gctgccctcg gcgggcgagg tcatcaacga ggtcccgtac       900
     aacgaggccc aggtccccga ggaccagctg aagtcgctga tgacgctgac cacgtgccac       960
     ccgcgcttct cggacaagca gcggctgatc gtgcacgcga cgctggccca gcactacccg      1020
     aagtcggacg gcttcctgcc ccccgagctc aaggagcagt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page