(data stored in ACNUC7421 zone)

EMBL: CP001630.PE170

CP001630.PE170       Location/Qualifiers
FT   CDS_pept        complement(188197..188499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0173"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34144"
FT                   /db_xref="GOA:C6WDZ9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ9"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU34144.1"
FT                   /translation="MSTNGRNAEIAELIARLTVLMTASPERQVPAQRPAPVRVLLTVEE
FT                   AAERLGIGKTKAYALVKAGSLESVLIGRLRRVHVDAIDHYTARLVAEQSSARPAA"
     atgagcacca acggtcgcaa tgcggagata gcggaactga tcgccaggtt gaccgttctc        60
     atgaccgctt cccctgagcg ccaggtccct gcgcaacgcc ccgcgccggt gcgggtcctg       120
     ctgaccgtgg aggaagccgc cgaacggctc ggcatcggca agaccaaggc ttacgcgctg       180
     gtcaaggccg gttcccttga gtcggtgctg atcggccgac tgcggcgcgt ccacgtggac       240
     gcgatcgacc actacaccgc tcggctggtc gccgagcagt cttccgcccg tccggccgct       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page