(data stored in ACNUC7421 zone)

EMBL: CP001630.PE171

CP001630.PE171       Location/Qualifiers
FT   CDS_pept        complement(188496..189647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34145"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:C6WE00"
FT                   /inference="similar to AA sequence:KEGG:RSc2483"
FT                   /protein_id="ACU34145.1"
FT                   /translation="MSAALRAVPTAQPAPGHVVLDQVRDFVKRFSVFPDEHCAPTLALW
FT                   YAHTWVADAFYTTPRLVLSSPEAGSGKTRVLEIAQHLTREPEMTAGGSAAALVRMVAAG
FT                   PISILMDEVDTVFGTGGAGNEEVRQMLNLGYKRTATIPKTKGDPASGFTVERLPIFAPA
FT                   ALAGLAGRMPDTITTRAITIHLRRRRHDEPVEPYRESKVVRQATPIREALGDWTASIGE
FT                   NLIEAEPDMPPGVEDRPAEIWEPLLAIADVAGGHWPETARAACSHFVLNQKSTQTLGVR
FT                   LLDDLRALFTAEGTERMHTAEIVTRLRGLEDAPWADLNGKPLDSRQLARQLSLYQVAPL
FT                   TFKHKNTNAKGYVTYPTNTQVTQVGLADAWARYLAPEHNGGAV"
     atgagcgccg cgctacgggc cgtgccgacc gcacagcccg cacctggcca cgtggttctc        60
     gaccaggtcc gtgacttcgt gaagcgcttc tccgtgtttc ccgacgagca ctgcgcgccg       120
     acgttggcgc tctggtacgc gcacacctgg gtggcggacg ccttctacac gacgccacgg       180
     ctggtgctgt cctctccgga agcgggatcg gggaagacgc gcgtgctgga gatcgcgcag       240
     cacctcacca gggaaccgga gatgacggcc ggtggttcgg ctgccgcgct cgtgcggatg       300
     gtcgcggccg gaccgatcag catcctcatg gacgaggtcg acacggtctt cggcacgggc       360
     ggggcgggca acgaggaagt ccgccagatg ctcaacctcg ggtacaagcg gaccgccacg       420
     atcccgaaga ccaagggcga cccggcgtcg gggttcacgg tggagcgtct gccgatcttc       480
     gcccccgcag cgctggccgg gctcgccggg cggatgcccg acacgatcac cacccgcgcc       540
     atcacgatcc acctgcgccg ccgccggcat gacgagccgg tcgagccgta ccgggagtcc       600
     aaagtggtcc ggcaggccac cccgatccgg gaagcgctcg gcgactggac ggcgagcatc       660
     ggcgaaaacc tgatcgaggc tgagccggac atgccgccgg gtgtggagga ccgaccggca       720
     gagatctggg aaccgctgct ggcgatcgcc gacgtggccg gcgggcactg gccggagacc       780
     gctcgggccg cgtgcagcca cttcgtgctc aaccagaagt ccacccagac gctcggcgtt       840
     cgtctactgg acgacctgcg cgcgctgttc accgctgagg gcaccgagcg gatgcacacc       900
     gccgagatcg tgacccggct gcgcgggctg gaagacgcgc cgtgggccga cctgaacggc       960
     aagccgctcg attcccggca gctcgccagg caattgagcc tctaccaggt cgcgccgctg      1020
     accttcaagc acaagaacac caatgccaag ggctacgtca cctatcccac caatacccag      1080
     gtaacccagg tcgggcttgc cgacgcttgg gcgcgctacc tggctcccga gcacaacgga      1140
     ggggccgtat ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page