(data stored in ACNUC7421 zone)

EMBL: CP001630.PE172

CP001630.PE172       Location/Qualifiers
FT   CDS_pept        complement(189644..190216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34146"
FT                   /db_xref="UniProtKB/TrEMBL:C6WE01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34146.1"
FT                   /translation="MNADYRRPFCDPDSQRPWNRPAHASTDPVRAWAEPLLRRAYAAAR
FT                   QQPAGCSHGPIPCVGSREWAALPDTDPRKPAAVVMAALARVEENTPHAIATRVAADWAD
FT                   AQMGRRERAREVAHAPDELGHIIGHLPFCLSERRKLTSELPCAHRGCPRVVRFTHPLPN
FT                   ALAARLPDTSWVRCDAHGGTKRLGVAA"
     atgaacgctg actaccgacg cccgttctgc gacccggact cccaacgccc gtggaatcgc        60
     cccgcccacg ccagcaccga ccccgtccgc gcttgggccg aaccgctgct gcgccgcgcc       120
     tacgccgccg cccggcagca gcccgccggg tgctcgcacg gcccaatccc ctgcgtcggg       180
     agcagggagt gggccgcgct gcccgacacc gacccccgca agcccgccgc cgtggtgatg       240
     gccgcgctgg cgcgggtgga ggagaacacc ccgcacgcca tcgccacccg tgtcgccgcc       300
     gactgggccg atgcccagat gggccgccgg gaacgcgccc gcgaggtcgc ccacgccccg       360
     gacgagctgg ggcacatcat cgggcacctg ccgttctgcc tgtccgagcg gcgcaagctc       420
     accagcgagc tgccctgcgc tcaccgcggc tgcccgcggg tggtccgctt cacccacccg       480
     ctcccaaacg ccctggcggc caggctgccc gacacgtcct gggtgcgctg cgacgcccac       540
     ggcggcacca agcggttggg agtggcggca tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page