(data stored in ACNUC7421 zone)

EMBL: CP001630.PE173

CP001630.PE173       Location/Qualifiers
FT   CDS_pept        complement(190299..190574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34147"
FT                   /db_xref="GOA:C6WF15"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34147.1"
FT                   /translation="MDPLTTIITTPALLITAITVGYLLTCAIWPFKRCRKCRGAGRHRS
FT                   PVMRAYRTCGHCRGDGYRLRIGRHVWNALTRNGRARRANRKNRKDL"
     gtggaccccc tcacgacgat catcaccact cccgcgctgc tcatcaccgc aatcaccgtg        60
     ggttacctgc tcacctgcgc gatctggccg ttcaagcgct gccggaagtg ccggggcgcg       120
     ggccgccacc gctcgccggt catgcgggcg taccgcacct gcggccactg ccggggcgac       180
     ggctaccggc tccggatcgg ccgccacgtg tggaacgccc tgacccgcaa cggccgtgcc       240
     cgccgggcca accgcaagaa ccgcaaggac ctctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page