(data stored in ACNUC7421 zone)

EMBL: CP001630.PE174

CP001630.PE174       Location/Qualifiers
FT   CDS_pept        complement(190727..192922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0177"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG:
FT                   bac:BamMC406_0006 cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34148"
FT                   /db_xref="GOA:C6WF16"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF16"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACU34148.1"
FT                   /translation="MSLPTARSTPDPDENNVVHLADARARAAATEPTAVVERAPEVLDA
FT                   EVVEDDAPTELVQVDQPDSSDDSTWVSRLRETERLPIIPGYLRTLSEVRQTAAWVGRHY
FT                   AHATGYHAARTPLYLLKLAARSPQGALLLMAATGRWVADAEGRPLRREMAVRGEAEKYL
FT                   RLVQERNARVRFRTVLLAAGSALGVVLLVLLPGVAPEWVWWVCVTAALAVLGKLGTPQD
FT                   RPVAGRAVVGPQAQKLTSDVVVRALSSLGIGGINQAVGKNAHAIGFTAPITRDGPGWRA
FT                   DVELPPGVTATEVVEKRDKLASGLGRPLGCVWPENNASGHPGQLVLWVGDRDMSKAKQP
FT                   AWSLRRGGAVDLFKPQPFGTDVRGRWVEVTLMFVAGIIGAIPRMGKTFTLRELLLIAAL
FT                   DPRSELHSYDLKGTGDLSPLAPVCHRYRAGDDPEDLEYAVADLRALRQELRRRTKVIRE
FT                   LPKDLCPENKVTTELASKRSLRLHPIVIGVDECQVWFEHPEFGAEVEEICTDLVKRGPA
FT                   TGIVLLLATQRPDSKSIPTQISDNAVLRFCLKVTGQMANDMVLGTSSYRNGERATQFSF
FT                   SDKGIGLLKGVTDETKTVKGVYVDGPGAETIAGRARALRTAAGLLTGYAAGLDAEVVDG
FT                   DVTSTLLPDVLAAMGSADKMWSESIVERLAELRPGAYGQWADQDGKGRAVQLAAALKPH
FT                   GVSTGQVWGTDADGKGANRRGLTRADVAAAVTDSASK"
     atgagcctgc ctaccgcgag gagcaccccc gaccccgacg agaacaacgt ggtccacctg        60
     gccgacgcac gcgccagggc tgccgcgacc gaaccgaccg ccgtggtgga gcgggcgccg       120
     gaggtcctgg acgccgaggt ggtggaggac gacgccccga ccgagctggt gcaggtcgac       180
     cagccggaca gctcggacga ctccacctgg gtgtcccggc tgcgggagac cgagcggctg       240
     ccgatcatcc ccggctacct gcgcacgctg tccgaggtgc ggcagaccgc cgcgtgggtg       300
     ggcaggcact acgcccacgc caccggctac cacgcggcgc gtaccccgct gtacctgctc       360
     aagctcgccg cgcggtcccc acagggcgcg ttgctgctca tggcagcgac cggccggtgg       420
     gtagctgatg ccgagggacg tccgctgcgg cgggagatgg cggtcagggg tgaggcggag       480
     aagtacctcc gcctggtgca ggagcggaac gcgcgggtcc ggttccggac tgtcctgctg       540
     gcggccgggt cggcactcgg cgtggtgctg ctggtgctgt tgcccggtgt cgcgcccgaa       600
     tgggtgtggt gggtctgcgt caccgcagcg ctggcggtac tgggcaagct cggcacgccg       660
     caggaccggc cggtcgccgg gcgtgccgtg gtcgggccgc aggctcagaa gctcaccagt       720
     gacgtggtgg tgcgggcgct gtcctccctc ggcatcggcg ggatcaacca ggccgtgggc       780
     aagaacgccc acgcgatcgg gttcaccgcg cccatcaccc gcgacggccc cggctggcgg       840
     gcggacgtgg aactaccgcc gggcgtgacc gccaccgagg tggtggagaa gcgggacaag       900
     ctcgcgtccg ggctggggcg tccgctgggt tgcgtgtggc cggagaacaa cgccagcggc       960
     caccccggtc agctcgtgct gtgggtcggg gaccgggaca tgtccaaggc caagcagccc      1020
     gcgtggtcac tgcggcgcgg tggcgcggtc gacctgttca agccgcagcc gttcggcacg      1080
     gacgtgcgcg gccggtgggt cgaggtcacg ctcatgttcg tcgccgggat catcggcgcg      1140
     atcccccgca tgggcaagac gttcacgctc cgggagctgc tgctcatcgc cgcgctcgac      1200
     ccgcgctccg agctgcactc ctacgacctc aagggcaccg gcgacctgtc gccgctcgcc      1260
     ccggtgtgcc accggtaccg ggccggtgac gacccggagg acttggagta cgcggtagcc      1320
     gatcttcggg cactgcggca ggaactccgg cggcgcacca aggtgatccg ggagctgccc      1380
     aaggacctgt gcccggagaa caaggtcacg accgagctgg cgtcgaagag gtcgctgcgg      1440
     ttgcacccga tcgtcatcgg cgtggacgag tgccaggtgt ggttcgagca cccggagttc      1500
     ggcgcggagg tcgaggagat ctgcaccgac ctggtgaagc gcggtccggc caccgggatc      1560
     gtgctgctgc tggcgaccca gcggcccgat tccaagtcga tccccacgca gatcagcgac      1620
     aacgcggtgc tgcggttctg cctcaaggtc accgggcaga tggcgaacga catggtgctg      1680
     ggcaccagca gctaccgcaa cggcgagcgg gccacccagt tctctttctc cgacaagggg      1740
     atcgggctgc tgaagggcgt caccgacgag acgaagacgg tcaagggcgt ctacgtggac      1800
     gggcccggcg cggagaccat cgcgggccgc gctcgtgcgc tgcggacggc cgccgggttg      1860
     ctcaccgggt acgccgccgg tctggacgcc gaggtggtcg acggggacgt gacgtccacg      1920
     ctgctgccgg acgtgctggc cgcgatgggc tcggcggaca agatgtggtc cgagtccatc      1980
     gtggagcggt tggccgagct gcggcccggt gcctacgggc agtgggccga ccaggacggc      2040
     aagggccgcg cggtgcagct cgctgcggcg ctcaagccgc acggggtcag caccggccag      2100
     gtctggggta ccgacgcgga cggcaagggc gccaaccgtc ggggcctcac ccgcgccgac      2160
     gtcgccgcag ccgtgacgga cagtgccagc aagtag                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page