(data stored in ACNUC7421 zone)

EMBL: CP001630.PE175

CP001630.PE175       Location/Qualifiers
FT   CDS_pept        complement(192919..193884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmv:BMASAVP1_A1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34149"
FT                   /db_xref="GOA:C6WF17"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34149.1"
FT                   /translation="MTSAYPPQLDRLAMKVDKLADDHGRLPSRNEVMRTFKVGGPKAKA
FT                   ALDAVKAMRSAGFVAGTSLVTSPTRRLHSVPTPDEGTAEDTTEFGTEHDAAPAAEHAEP
FT                   ASAPADITTSTTVDAVVPTPATRAEPAPSTQVSTLADLGTPHVPTGGAVEQGRVRGAWA
FT                   VLTNRTAEPRQARQVRPWPVLVIALGAFVAIWGGWVELGKLTGFGEITPLPGIADGWTI
FT                   DSAITLPLGVEAYAAFALRVWLSDTTRSGRARRFAKWSALGALVLGAAGQVAYHLMSAA
FT                   GLTSAPWQITTAVSCLPVIVLGLGAALAHLMHNGDQEVTR"
     atgaccagcg cctaccctcc ccagctcgac cgcctcgcca tgaaggtcga caagctcgcc        60
     gacgaccacg gccgtctccc ctcgcgcaac gaggtgatgc gcaccttcaa ggtcggcggc       120
     cccaaggcca aggccgcgct ggacgcggtc aaggccatgc gatccgcagg gttcgtggcg       180
     ggcaccagtc tggtcacgtc ccccactcgg cggctgcact ccgtgcccac cccggatgag       240
     ggcaccgcag aggacaccac cgagttcggc accgagcacg acgccgcccc ggccgctgag       300
     cacgccgagc ctgcgagcgc cccagccgac atcaccacca gcaccacggt ggacgcggtg       360
     gtccccactc cggcgaccag ggctgagcca gccccgtcca cccaggtcag caccctcgca       420
     gacctgggca cgccccacgt cccgaccggc ggcgcggtgg agcagggcag ggtccggggt       480
     gcgtgggcgg tgctcaccaa ccgcaccgcc gagccccggc aggcgcgcca ggtccggccg       540
     tggccggtgc tggtgatcgc gctcggcgcg ttcgtcgcca tctggggcgg ctgggtggag       600
     ctgggcaagc tcaccgggtt cggcgagatc accccgctgc ccggcatcgc ggacggctgg       660
     accatcgact ccgcgatcac gctcccgctc ggggtcgagg cgtacgcggc gttcgcgctg       720
     cgggtctggc tctccgacac caccaggtcc gggcgcgccc gccggttcgc caagtggtcc       780
     gcgctcggcg cgctggtgct cggcgcggcc ggacaggtcg cctaccacct catgtccgcc       840
     gccgggctga cctccgcccc gtggcagatc accacggcgg tgtcctgcct cccggtcatc       900
     gtgctcgggc tcggcgctgc cctggcgcac ctgatgcaca acggcgacca ggaggtgacc       960
     cgatga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page