(data stored in ACNUC7421 zone)

EMBL: CP001630.PE177

CP001630.PE177       Location/Qualifiers
FT   CDS_pept        complement(194069..194224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34151"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34151.1"
FT                   /translation="MITTNCRGCGEIADCDINELCDYCANDPEINPDLCDECGGFGCEW
FT                   CTEIYE"
     gtgatcacga cgaactgccg aggctgcggc gagatcgccg actgcgacat caacgagctg        60
     tgcgactact gcgccaacga cccggagatc aaccccgacc tctgcgacga gtgcggtggc       120
     ttcgggtgcg agtggtgcac cgagatctac gagtga                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page