(data stored in ACNUC7421 zone)

EMBL: CP001630.PE178

CP001630.PE178       Location/Qualifiers
FT   CDS_pept        complement(194253..194564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34152"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34152.1"
FT                   /translation="MNTPATYPDGLTWAVLNALQEQVSREDVPAAEPTSALVSGEAQMR
FT                   RNLRVLRRALNGVTAHHGVGLMQAVAELRETFPHLLVTTAEDSSQVEPIASPAVRRVA"
     gtgaacaccc cagccacgta ccccgacggc ctcacgtggg ctgtcctgaa cgcccttcag        60
     gagcaggtct cgcgtgagga cgtcccggcc gccgagccga cctctgcgct ggtcagcggt       120
     gaggcgcaga tgcgccggaa cctgcgcgtc ctgcgccggg cgctcaacgg cgtgacggcc       180
     caccacggcg tcggcctgat gcaggccgtc gccgagctgc gcgagacgtt cccgcacctg       240
     ctggtgacca ccgccgagga cagctcccag gtggagccca tcgcgtcgcc cgccgtccgg       300
     cgggtggcct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page