(data stored in ACNUC7421 zone)

EMBL: CP001630.PE179

CP001630.PE179       Location/Qualifiers
FT   CDS_pept        194728..195081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0182"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34153"
FT                   /db_xref="GOA:C6WF21"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF21"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU34153.1"
FT                   /translation="MIPDWEGVATAINARLSDRGMKQQELAERSGVSVAALRLLQKAKA
FT                   TNARPRTLAAVSEALGWPREHLAAVRDGRTPSDGAARPEPTVAELAAAMEDLRERVAEL
FT                   ERVVGEGSSERRA"
     ttgatacccg actgggaagg cgtcgccacc gcgatcaacg ctcggttgag cgatcgcggg        60
     atgaagcagc aggagctggc ggagcgctcc ggggtgagcg tcgccgcgct gcggctgctc       120
     cagaaggcca aggcgaccaa cgcgcgcccg cgcaccctcg cggcggtgtc cgaagcgctg       180
     gggtggccgc gcgagcacct ggctgccgtc cgggacgggc gaacgccgtc cgatggcgct       240
     gcccgtccgg agccgaccgt ggccgagctt gccgcagcga tggaagacct gcgggagcgg       300
     gtcgctgagt tggagcgggt ggtaggcgag ggaagttccg agcgaagagc atga             354
//

If you have problems or comments...

PBIL Back to PBIL home page