(data stored in ACNUC7421 zone)

EMBL: CP001630.PE181

CP001630.PE181       Location/Qualifiers
FT   CDS_pept        196208..196987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0184"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: smt:Smal_1152
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34155"
FT                   /db_xref="GOA:C6WF23"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF23"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACU34155.1"
FT                   /translation="MELNGAPVTLEEVKALALTNYGHFTSMLAEDGKVRGLSLHLQRLA
FT                   RDCRLLFDVELDTDMVRHCVRSALPDSGDRTVVRVTSYDPGIDLGTIGSDATPHILVTK
FT                   RSASDKVPSPMRLQAASYQRELPTVKHIGLFGALQRRRTAQREGFDDVLFLNPDGYISE
FT                   VATSNIGFVRDGQIVWPRAAYLAGITMTLLHQELDEPVSTEPLSLADLGQMEAAFATNA
FT                   STGVREILSVDDVAWESGHPMLGELRKMYEDIPAETV"
     atggaactca acggcgcgcc ggtgaccctg gaagaggtca aagccctggc gctcacaaac        60
     tacggccact tcacgtcgat gttggcagag gatggcaagg tgcgcggttt gtcgctgcac       120
     ttgcagcgct tggcgcgcga ttgccgtctc ctgttcgacg tggaattgga caccgacatg       180
     gtgcgccact gcgttcggtc cgcgctgccg gattccgggg accgcaccgt ggtccgcgtg       240
     accagctatg acccaggtat cgacctgggc accatcggtt ccgacgccac gccgcacatc       300
     ctcgtcacca agcgctcggc gtccgacaag gtcccatcgc cgatgagatt gcaggcagcg       360
     tcctaccagc gcgaacttcc cacggtgaag cacatcggcc tgttcggtgc cctccagcgc       420
     cgccgcaccg cgcagcgcga gggctttgac gacgtgctct tcctgaaccc cgacggctac       480
     atctccgagg tggccacgtc gaacatcggg ttcgtgcgag acggtcagat cgtgtggccg       540
     cgcgccgctt acctggcggg gatcacgatg accctgctgc accaggagct tgacgaaccg       600
     gtgtccactg aaccgctttc cctggctgat ctgggccaga tggaagcggc attcgccacc       660
     aacgcctcga ccggtgtccg ggagatcctg tcggttgacg acgttgcttg ggaaagcggt       720
     cacccgatgt tgggggagtt gcggaagatg tacgaagaca ttccggccga gacagtgtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page