(data stored in ACNUC7421 zone)

EMBL: CP001630.PE182

CP001630.PE182       Location/Qualifiers
FT   CDS_pept        197023..197958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0185"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: protein of unknown function DUF323; SMART:
FT                   helix-turn-helix domain protein; KEGG: scl:sce5487 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34156"
FT                   /db_xref="GOA:C6WF24"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF24"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACU34156.1"
FT                   /translation="MATVQSWSGVEVRALREAKRMSIREFAAHLGVSERMISKWEAGRE
FT                   SIRPRPVNQAALDTCLTRSDPDTKARFSLLTGDSLVPGSGENVQVEPIGSSQVHHPADG
FT                   SLMVKVDGSVFLSGPSNTPVWIPDFYIDVYPVSNADYARFIVATGHAPPHHWPDGRHPA
FT                   ELVDHPVVFVTWEDAAAYAAWAGKALPTSQQWEKAARGTRGTVYPWGDQPTPAKCNVRE
FT                   NGVGQTTRRDCYQSGASPYGVYDLCGNVWEWCATESKPGRRELRGGAWTSPFNRATPSS
FT                   FNDAAVSMCDDDTGFRCVAPVEAFGGREAK"
     atggcgaccg tgcagagttg gtccggggtg gaagttcggg cgctgcgtga agcgaagagg        60
     atgagcatcc gcgagttcgc ggcccacctg ggcgtcagcg agcggatgat ctccaagtgg       120
     gaggcagggc gtgagtcgat cagaccgcgc ccggtcaacc aagctgcgct ggacacgtgc       180
     ctgacccgaa gcgatcccga cacgaaggca cggttctctt tactcactgg cgattcgctg       240
     gtgccaggct cgggggagaa cgtccaggtc gagccgatcg gctccagcca ggtgcaccac       300
     ccggcggacg gcagcctgat ggtgaaggtg gacggcagcg tcttcctgtc cggcccgagc       360
     aacaccccgg tgtggatccc ggacttctac atcgacgtct acccggtgtc gaacgcggac       420
     tacgcgaggt tcatcgtggc caccggccac gccccgccgc accactggcc ggacgggcgc       480
     cacccggcgg agttggtgga ccacccggtg gtcttcgtga cctgggagga cgcagcggcc       540
     tacgcggcgt gggcgggcaa ggcgctgccg acatcccagc agtgggagaa agcagcacga       600
     ggaacccgcg gcacggtcta cccgtggggt gaccagccga ccccggcgaa gtgcaacgtg       660
     cgggagaacg gcgtgggcca gacgacccgc cgcgactgct accagagcgg cgcgagcccg       720
     tacggggtat acgacctgtg cgggaacgtg tgggagtggt gcgcgacgga gtccaagccg       780
     ggccgccgag agctgagggg cggcgcgtgg accagcccgt tcaaccgcgc caccccgtcg       840
     tcgttcaacg atgctgcggt gtcgatgtgt gacgatgaca ccgggttcag gtgcgttgcc       900
     ccggtggagg cgttcggcgg cagggaagca aagtga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page