(data stored in ACNUC7421 zone)

EMBL: CP001630.PE184

CP001630.PE184       Location/Qualifiers
FT   CDS_pept        complement(198251..198898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_0912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34158"
FT                   /db_xref="GOA:C6WF26"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34158.1"
FT                   /translation="MIATFQGLLVALLALLPGASYTFAYERVAGGYGISFADRLVRFLA
FT                   SSALFHALFSGPEYLLYRDLFKNNRLQGGGVDWWLVEAVALAYVLVPVAVGALLGWGHK
FT                   HHKKWAVLLVGNAPEPRAWDYFWRHTDRAVVRLKLKSGMWLAGLYGMAGNGRRSYASGH
FT                   PEEGDLYLAVALEINNQSGELTLTDEQVTPLPGARGLLVRWPEIEYIDIQEY"
     atgatcgcca ccttccaggg gctgctggtg gcgctgctgg cgctgctgcc cggcgcgtcc        60
     tacacgttcg cctacgaacg cgtcgcgggc ggctacggca tcagcttcgc cgaccggctc       120
     gtgcgcttcc tggcctcctc cgcgctgttc cacgccctgt tctcgggacc ggagtacctg       180
     ctctaccgcg acctgttcaa gaacaaccgc ctgcagggcg gcggcgtcga ctggtggctc       240
     gtcgaagccg tcgccctcgc ctacgtcctg gtcccggtcg ccgtcggggc gctcctgggc       300
     tgggggcaca agcaccacaa gaagtgggcg gtcctgctgg tcggaaacgc gccggaacca       360
     cgggcctggg actacttctg gcgccacacc gaccgcgccg tggtccgcct caagctcaag       420
     tccggcatgt ggttggccgg tctctacggc atggctggca acggacgccg ttcctacgcc       480
     tcgggccacc cggaagaggg agacctctac ctggcagtag ccctcgagat caacaatcag       540
     agtggcgagt tgaccttgac cgatgaacaa gtcaccccgc tgccgggcgc acgcggcctg       600
     ctcgtgcgct ggcccgagat cgagtacatc gacatccagg agtactag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page