(data stored in ACNUC7421 zone)

EMBL: CP001630.PE185

CP001630.PE185       Location/Qualifiers
FT   CDS_pept        complement(198895..199368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C1257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34159"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF27"
FT                   /inference="similar to AA sequence:KEGG:Bxe_C1257"
FT                   /protein_id="ACU34159.1"
FT                   /translation="MIIGVSGHQDLPASAQAHAEKRIRALLAEQAAPVTGVGSLAEGAD
FT                   QLFAQLVLAAGGSLHVVIPSRGYETTFAVEARCLYRELLARADTVTELDFPEPGEQAYY
FT                   AAGHHVAECCDLLVAVWDGQPARGLGGTADAVAHARELGRDVMIVWPEGVRRT"
     atgatcatcg gggtgagcgg gcaccaggac ctgcctgcgt ccgcgcaggc gcacgccgag        60
     aagcgcatcc gcgcgttgct ggccgaacag gccgcgccgg tgaccggtgt cggcagcctc       120
     gccgagggcg cggaccaact gttcgcgcag ctggtcctgg ccgccggtgg cagcctgcac       180
     gtcgtcatcc cctcacgcgg ctatgaaacc accttcgcgg tagaggcgcg gtgcctctac       240
     cgcgaactgc tcgcgcgtgc ggacacggtc accgagctgg acttccccga gcccggcgaa       300
     caggcctact acgccgccgg gcaccacgtc gccgagtgct gcgacctgct cgtcgcggtc       360
     tgggacggac aaccggcgcg cgggctcggc ggcaccgccg acgccgtcgc gcacgcccgt       420
     gaactcggac gcgacgtgat gatcgtgtgg cccgagggcg tacgaaggac atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page