(data stored in ACNUC7421 zone)

EMBL: CP001630.PE186

CP001630.PE186       Location/Qualifiers
FT   CDS_pept        complement(199368..200309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0189"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: bcr:BCAH187_E0055 peptidase C14 caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34160"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF28"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACU34160.1"
FT                   /translation="MKRALLVGIDRYKNFQPLAGCVNDANAVKPLLARNEDNSLNFHCK
FT                   LLLDAVERDQLLEEVDALLGGGADFALLYFAGHGAGVGDDLTLVTTNGTPQSPGVRFAD
FT                   VLERIGRSPVREVVVILDCCFSGNAGNVPVLGAGSAYLREGLSILTASRGDQTSAEARG
FT                   RGVFSTYLEGALDGGASDVMGHVTVAGLYAYLSELFGAWDQRPTFKANVDRLQDLRACK
FT                   SAVPLDTLRSLADWFPTAEAEFPLDPSYEPDAEPENLEHEDVFKQLQVCRANKLVEPID
FT                   TDHMYYAAMNSTGCRLTPLGKRYWQLAERENI"
     gtgaagcgcg cgctactggt cggaatcgac cgctacaaga acttccagcc tctggcgggg        60
     tgcgtcaacg acgccaacgc ggtgaagccg ctgctggccc gcaacgagga caacagcctc       120
     aacttccact gcaagctcct gctcgatgcc gtcgagaggg atcagttgct ggaggaagtc       180
     gacgcgcttc tcggcggcgg ggccgacttc gcgctgctct acttcgccgg gcacggtgcc       240
     ggagtcggcg acgaccttac gctcgtgacc acgaacggga ccccgcagag ccccggcgtg       300
     aggttcgccg atgtgctcga gcgcatcggc aggtcgccgg tccgggaggt ggtggtgatc       360
     ctggactgct gcttctccgg caacgcgggc aacgtgcccg tgctgggcgc cgggtcggcg       420
     tacctgcgtg aggggctgtc catcctgacc gccagtcgcg gcgaccagac ctccgccgag       480
     gcccgcggac gcggtgtgtt ttccacctac ctggagggcg cgctcgacgg cggcgcctcc       540
     gacgtcatgg gccacgtcac cgtcgcgggc ctctacgcct acctgtccga gctgttcggg       600
     gcgtgggacc agcgccccac cttcaaggcc aacgtcgaca ggctgcagga cctgcgcgcc       660
     tgcaaatccg ctgtcccgct ggacaccctg cggtcgctgg ccgactggtt ccccacagcc       720
     gaggccgagt tcccgctcga cccgagctac gaacccgacg cggagccgga gaacctcgag       780
     cacgaggacg tgttcaagca actgcaggtg tgccgcgcca acaagctcgt cgagccgatc       840
     gacacggacc acatgtacta cgccgccatg aacagcacag gctgcagact gaccccgctg       900
     ggcaagcgct actggcagct ggccgaacgg gagaacatct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page