(data stored in ACNUC7421 zone)

EMBL: CP001630.PE187

CP001630.PE187       Location/Qualifiers
FT   CDS_pept        complement(200314..200691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0190"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   sbm:Shew185_4383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34161"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR036490"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF29"
FT                   /inference="protein motif:PFAM:PF08937"
FT                   /protein_id="ACU34161.1"
FT                   /translation="MADKKTVFIAFAMEDERDRDLFVGQRLNSRTPYEYTDMSVKEPYE
FT                   TQWKERVLARVRRSHGVIALISPSTVQAEGQLWEIECAVEEGKPLLGIFIKEQRIKPAV
FT                   MGSAPCVAWTWKAVEDFIDGL"
     atggctgaca agaagacggt gtttatcgcg ttcgcgatgg aggacgagcg cgaccgcgac        60
     ctgttcgtgg ggcagcgact caactcgcgc accccgtacg agtacaccga catgtccgtg       120
     aaggagccct acgagacgca gtggaaggag cgggtcctgg cccgggtgcg ccgttcgcac       180
     ggcgtcatcg cgctgatcag cccgagcacc gtgcaggccg agggacagct gtgggagatc       240
     gagtgcgcgg tggaggaggg caagccgctg ctgggcatct tcatcaagga gcagcgcatc       300
     aagcccgccg tgatggggtc ggcgccgtgc gttgcctgga cgtggaaggc cgtcgaagac       360
     ttcatcgacg ggctgtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page