(data stored in ACNUC7421 zone)

EMBL: CP001630.PE188

CP001630.PE188       Location/Qualifiers
FT   CDS_pept        complement(201557..202771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0191"
FT                   /product="protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   bmj:BMULJ_02352 protein-L-isoaspartate (D- aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34162"
FT                   /db_xref="GOA:C6WF30"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR026448"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF30"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ACU34162.1"
FT                   /translation="MTTVPEDEWRERAAALADMLGELGKLTDPAWREAVRAVPRHVLVP
FT                   RFHTQDTNGTWVESSTSTKEGRAAWLDAVYSNKPLVTALRQDAEVGRVVSSSSQPGLMT
FT                   RMLEALDIRDGHRVLEIGTGTGYNAALLSHRLGGENVFSVDVEPDLVDLARSRLAELGH
FT                   APTLVAANGALGLAEHAPFDRIIATCAVPAIPWAWIEQLRVGGTVLTDLKITQNAGNLV
FT                   KVTRTSEHRAEGRFDPTYAAFMGLRHQPGGPAQPVTRAARDSADVHESTSPVDPQTPWK
FT                   NMVVWFLAALDLHADVTIGYTGPSTTSPPTAVTLSTSDGSWAQIALAGAHGLHEVTQGG
FT                   PQRLWQAVENAHDLWNHLSRPDWGQFGLTITPNSHTLWHDRPDSEQHWTHLTEMIHGKR
FT                   WAKQL"
     gtgacgaccg tccctgaaga cgagtggcgc gagcgcgccg ccgcgctggc cgacatgctc        60
     ggcgaactag gcaagctcac cgacccggca tggcgggagg cggtgcgcgc cgtcccccga       120
     cacgtactcg tgccgcgctt ccacacccag gacacgaacg ggacgtgggt cgagtccagc       180
     accagcacca aagaggggcg ggcggcgtgg ctggacgcgg tgtactccaa caagccattg       240
     gtcaccgcgc tgcgccagga cgccgaagtg ggcagggtgg tgtcctcgtc cagccagccc       300
     ggcctgatga ccaggatgct ggaagccctg gacatccggg acgggcaccg ggtgctggag       360
     atcggcaccg gcaccggata caacgccgcc ctgctctcgc accggctcgg cggggagaac       420
     gtgttctccg tcgatgtcga acccgacctg gtcgacctgg cccggtcgcg gctggccgag       480
     ctggggcacg cgccaacact ggtggccgcg aatggggcgc tcggcctggc ggagcacgcg       540
     cccttcgacc ggatcatcgc cacctgcgcc gtgcccgcca tcccctgggc ctggatcgag       600
     cagctgcggg taggcggcac ggtgctgacc gacctgaaga tcacccagaa cgcgggcaac       660
     ctggtcaagg tcacgcgcac ctcggaacac cgcgctgaag gccggttcga cccgacctac       720
     gcggcgttca tggggctgcg ccaccagccc ggtggacctg cgcaaccggt gaccagagca       780
     gcacgtgaca gcgccgatgt ccacgagtcc acgagtcccg tagacccgca gacgccgtgg       840
     aagaacatgg tggtgtggtt cctcgccgca ctcgacctgc acgccgacgt gacaatcggc       900
     tacaccgggc cgagcaccac cagcccaccc actgccgtca ccctctcaac ctcggacggc       960
     tcatgggcgc agatcgccct tgccggagct cacgggctcc acgaggtcac ccagggcgga      1020
     ccacaacggc tctggcaggc ggtggagaac gcccacgacc tgtggaacca cctgagccga      1080
     ccggactggg gccagttcgg attgaccatc accccgaaca gccacaccct ctggcacgac      1140
     cgccccgaca gcgaacagca ttggactcac ctaacagaaa tgattcacgg gaagcggtgg      1200
     gcaaagcagc tttaa                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page