(data stored in ACNUC7421 zone)

EMBL: CP001630.PE189

CP001630.PE189       Location/Qualifiers
FT   CDS_pept        complement(202768..203733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34163"
FT                   /db_xref="InterPro:IPR026449"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF31"
FT                   /inference="similar to AA sequence:KEGG:sce7176"
FT                   /protein_id="ACU34163.1"
FT                   /translation="MTVLILAQEADAPTDAVVAELTRRGVEVFRADTSWFPRQLVLDAE
FT                   LVDGRWTGTLSTDHRTVDLHDIRSVWYRDPSAFVFPPDLTEVERAYAHREARLGFGGVL
FT                   AALPDVLWVNHPNRAADAMYKPLQLTTAAACGLYVVPTLVTNSPTAVRRFAAALPGGVV
FT                   HKSFGPNTVTEGGAVKVAYTRRFQPADLVDLRGVRSTALQAQAWVDKAVEARVVVLGER
FT                   MFTIVITANSTAAHEDWRADFDALTYELVDTPPEVEAGVRAYMRTLGLAYAALDFGIER
FT                   DTGRFVFYESNSAGQYGWLESQTGAPITAALADLLTGVPS"
     atgaccgtcc tcatcctggc ccaggaagcc gacgccccca ccgacgcggt ggtggccgag        60
     ttgacccgcc ggggtgtcga ggtgttccgc gccgacacga gctggttccc acgccagctc       120
     gtgctcgacg cggagctggt cgacggtcgg tggacgggta ccctgtccac cgaccaccgc       180
     acggtcgacc tccacgacat ccgatccgtc tggtaccgcg acccgtctgc gttcgtgttc       240
     ccgcccgatc tgaccgaggt cgagcgcgcc tacgcgcacc gtgaggcccg gctggggttc       300
     ggcggggtgc tggcggcact gcccgacgtg ctgtgggtga accacccgaa ccgggccgcc       360
     gacgcgatgt acaagccgtt gcagctcacc accgctgcgg cctgcgggtt atacgtggtg       420
     ccgacactgg tgacgaactc gccgactgcg gtgcggcggt tcgctgcggc gctaccgggt       480
     ggggtggtgc acaagtcgtt cgggccgaac accgtgaccg aaggcggtgc ggtcaaggtc       540
     gcgtacaccc gccggttcca gcccgctgac ctggtcgacc tgcgcggggt caggtcgacc       600
     gcgttgcagg cgcaggcgtg ggtggacaag gcagtggagg cccgcgtggt cgtgctgggc       660
     gaacggatgt tcaccatcgt gatcaccgcg aactcgaccg ccgctcatga ggactggcgg       720
     gcggacttcg acgccctgac ctacgagctg gtggacacgc cgcccgaggt ggaagccggg       780
     gtcagggcgt acatgaggac gctcgggctg gcgtatgcgg cactcgattt cgggatcgag       840
     cgggacaccg ggcgtttcgt cttctacgag agcaactcgg cgggccagta tgggtggctc       900
     gaatcccaga ccggtgcacc gatcactgcg gcgctggcag acctactcac gggagtgccc       960
     tcgtga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page