(data stored in ACNUC7421 zone)

EMBL: CP001630.PE19

CP001630.PE19        Location/Qualifiers
FT   CDS_pept        complement(19042..20388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0019"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ade:Adeh_3296 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33993"
FT                   /db_xref="GOA:C6WCH2"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH2"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ACU33993.1"
FT                   /translation="MSRSLRVAVVGAGPAGIYAADILTKSDAEVSIDLFERMPAPYGLI
FT                   RYGVAPDHPRIKGIVNALQKVLDRPEIRFFGNVEYGVDVKLEDLRQHYDAVIFSTGAEK
FT                   DRAMDVPGIELDGSYGAADFVSWYDGHPDVPRTWPLTASQVAVLGVGNVALDVARVLAK
FT                   TADELLTTEIPDNVYEGLKSSPVTDVHVFGRRGPAQAKFTPLELRELDHSPNVEVIVHP
FT                   EGIDFDEGSMASIRSSKQVEMVVKTLQEWALRDVGDRPRRLHLHFLEAPVEVTGEDGKV
FT                   VGLRTERMELAGDGNVKGTGEFTDWPVQAVYRAVGYLSTSLVDLPFDTASGTVPHAGGR
FT                   VVDLDEQPLPGVYVTGWIKRGPVGLIGHTKGDALETVTNLLADADALPACQFPEPDAIV
FT                   RFLEQRAVPFTTVEGWLKLDAHEKALGAERGRERVKVVDRETMTSVSRS"
     atgagtcgtt ccctgcgcgt cgccgtggtc ggcgcgggcc ccgcgggcat ctacgccgcc        60
     gacatcctga ccaagtccga cgccgaggtc tccatcgacc tgttcgagcg gatgcccgcc       120
     ccgtacggtc tgatcaggta cggcgtcgct cccgaccacc cccggatcaa ggggatcgtc       180
     aacgcgctgc agaaggtgct cgaccggccg gagatccgct tcttcggcaa cgtcgagtac       240
     ggcgtggacg tgaagctgga ggacctgagg cagcactacg acgccgtgat cttctcgacc       300
     ggcgccgaga aggaccgggc gatggacgtg cccggcatcg agctcgacgg cagctacggc       360
     gccgccgact tcgtctcctg gtacgacggc cacccggacg tgccccggac ctggcccctc       420
     accgcctcgc aggtcgccgt gctcggcgtc ggcaacgtcg cgctggacgt cgcccgcgtg       480
     ctggccaaga ccgccgacga gctgctgacc accgagatcc ccgacaacgt ctacgagggc       540
     ctgaagtcca gccccgtcac cgacgtgcac gtgttcggcc gccgcggccc ggcgcaggcg       600
     aagttcaccc cgctggagct gcgggagctg gaccactcgc ccaacgtcga ggtgatcgtg       660
     caccccgagg gcatcgactt cgacgagggc agcatggcct cgatccggtc gagcaagcag       720
     gtcgagatgg tcgtgaagac gctgcaggag tgggcgctgc gcgacgtcgg cgaccggccc       780
     cgcaggctgc acctgcactt cctggaggcc ccggtcgagg tgaccggcga ggacgggaag       840
     gtcgtcggcc tgcgcaccga gcgcatggag ctggcgggcg acggcaacgt gaagggcacc       900
     ggcgagttca ccgactggcc ggtgcaggcg gtgtaccggg cggtgggcta cctgtccacg       960
     agcctggtcg acctgccgtt cgacaccgcg tccggcacgg tcccgcacgc cgggggccgc      1020
     gtggtcgacc tggacgagca gccgctgccg ggcgtgtacg tcaccggctg gatcaagcgc      1080
     ggcccggtcg gcctgatcgg ccacaccaag ggcgacgcgc tggagaccgt cacgaacctg      1140
     ctggcggacg ccgacgcgct gcccgcctgc cagttccccg agccggacgc gatcgtccgg      1200
     ttcctggagc agcgcgccgt cccgttcacc acggtggagg gctggctgaa gctggacgcg      1260
     cacgagaagg cgctgggcgc cgagcgcggt cgcgagcggg tcaaggtcgt ggaccgggag      1320
     acgatgacct cggtctcccg gtcctga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page