(data stored in ACNUC7421 zone)

EMBL: CP001630.PE190

CP001630.PE190       Location/Qualifiers
FT   CDS_pept        complement(203733..204038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34164"
FT                   /db_xref="InterPro:IPR025843"
FT                   /db_xref="InterPro:IPR026496"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34164.1"
FT                   /translation="MADLPGTLVDTNPLSSSQLRNTIRAHAVSTAPGPDETRPFGLRFA
FT                   VTVPTPVRRTVSYCPTRQLAVDNERRPLIETMGKEWATKGSTDGDEGPEENWGWEE"
     atggccgact tacccggcac cctcgtggac accaaccccc tgtccagctc ccagctccgc        60
     aacaccatcc gcgcccacgc cgtgtcgacc gcccccggtc ccgacgagac ccggccgttc       120
     gggctgcggt tcgccgtgac cgttccgacg ccggtccgcc gaaccgtctc ctactgcccc       180
     acccggcagc tcgcggtcga caacgagcgc aggccgctga tcgagacgat gggcaaggag       240
     tgggccacca agggctccac cgacggcgac gagggtccgg aggagaactg gggctgggag       300
     gagtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page