(data stored in ACNUC7421 zone)

EMBL: CP001630.PE191

CP001630.PE191       Location/Qualifiers
FT   CDS_pept        204230..205435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0194"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein;
FT                   Tetratricopeptide TPR_4; SMART: helix-turn-helix domain
FT                   protein; KEGG: eca:ECA3401 putative phage regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34165"
FT                   /db_xref="GOA:C6WF33"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF33"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34165.1"
FT                   /translation="MAASPPATGENITVLRKAAGLTQRQLATRANISLSLLSKVEVGDR
FT                   AASNALVAAVARALAVPIERVHGQPYQAEHRESGVDNAIDRLRAALRGYDLAPDESVPL
FT                   RPVERLRADVEGVSRRRRSGRYSRLAFTLPALLEELTLARHSVTGAREQEEVFELLVMA
FT                   FYAAHGLAYRLGYADLAESIEHKLGWAADRTSDPLAVGLAQWTRVNAFQAAGDYGRGLQ
FT                   LLDNARHQLDEHVDLTGSAAVTVYGSLHLRASTLASRAGDADTARAHLGAAAELGVRVR
FT                   RDRVHYQLTFGPTNTAIHDVAASVELGDPERAVRIGADFKRGSGLPATRIGHLHIDLAR
FT                   AHLMLGDRPGTLRALEQARRAAPEQTRFHPMVRETTRVLVSLHRRSNPDLSKFATWIGL
FT                   AD"
     atggcagcga gtcccccggc gaccggcgag aacatcacgg tgctgcgcaa ggccgcaggg        60
     ctgacacagc gccagttagc cacccgcgcg aacatctcct taagcctgct gtccaaggtg       120
     gaggttggtg atcgcgccgc cagcaacgcg ctggttgccg ccgtcgcccg cgcgctcgcc       180
     gtgccgatcg agcgcgtcca cggccagcct taccaagccg agcaccgcga gagcggggtg       240
     gacaacgcca tcgaccggct gcgcgccgca cttcgcggct acgacctggc cccggatgag       300
     agcgtcccgc tccggcccgt cgaaagactc cgagccgacg ttgaaggggt gagtcggcgg       360
     cggcgttccg ggcgctactc ccggcttgcg ttcaccctcc ctgccctgct ggaagagctg       420
     actcttgccc ggcacagcgt caccggcgcc cgtgagcagg aagaggtctt cgagctgctg       480
     gtgatggcgt tctacgccgc gcacggcctg gcctaccggc tgggctacgc cgatcttgcc       540
     gagtcgatcg agcacaagct ggggtgggca gccgaccgga ccagcgaccc gctcgccgtg       600
     ggactggcgc agtggaccag ggtgaacgcc ttccaggccg caggggacta cggccgtggc       660
     ttgcagttgc tcgacaacgc ccgccaccag ctcgatgagc acgtggacct gaccggctcg       720
     gctgcggtca ccgtgtacgg cagcctgcac ctgcgggcca gcactctcgc ttcccgtgcc       780
     ggtgacgccg acaccgcccg cgcccacctc ggcgctgccg ctgaactcgg cgtgcgcgtc       840
     cgccgcgacc gggtgcacta ccagctgacc ttcggtccga cgaacaccgc gatccacgac       900
     gtcgccgctt cggtcgagct gggcgacccg gaacgcgccg ttcgcatcgg tgcggacttc       960
     aagcggggga gcggcctgcc cgccactcgg atcggccacc tgcacatcga cctggcgcga      1020
     gcacacctga tgctcggcga ccggcccggc accctgcgcg cgctggaaca agcccgccgc      1080
     gctgcgccgg agcagacccg gttccacccg atggtccggg agacgacccg cgtcctggtc      1140
     agcctgcacc gccgcagcaa cccggacctg agcaagttcg ccacctggat cgggctcgct      1200
     gactga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page