(data stored in ACNUC7421 zone)

EMBL: CP001630.PE192

CP001630.PE192       Location/Qualifiers
FT   CDS_pept        206393..208858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0195"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   scl:sce0688 endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34166"
FT                   /db_xref="GOA:C6WF34"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF34"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACU34166.1"
FT                   /translation="MRTTPLRAGLAAAAATVVSIASATPVTAAPSQDALIAEVYGGGGN
FT                   SGAVLTQDFVELANRASAPVAVDGWSVQYLPASASAASQWQVTPLTGSIAPNARYLVAQ
FT                   AKGAGGTTALPTPDATGATAMAAGAGTVALVSGTQPLTCKTAADCAAAPGVKDLVGYGT
FT                   TAVVREGGPTATLTSTTSAARPQLVDSDDNAADFTAGAPTPVNSKGEGVGQNPDPDPDP
FT                   DPDPQPGDKRIRDIQGATRISPLLGQKVTGVPGLVTATRATGDRGYWIQDAQPDGDPRT
FT                   SEGVFVYTGDAAPTVQPGDSVLVGGTIAEYRPGGVEAGNSNQTLTEITAPTTSVLSSGN
FT                   PLPAPERLAPPAGYLPTASGGSIEQLPLEPDKYALDYFESREGMLVEVVDARVTGPTNN
FT                   FGETWITTRPQDNPTARGGTVYLGYDQPNPGRLKAKAGSATPPVSDVGDVWSGSTVGNL
FT                   EYTNFGGYTLATKSVGAHAPGGTKPEVSDATGRHELSVATYNVENLAATNDQAKFDRLA
FT                   AAVVANLRSPDVVVLEEIQDDNGTANDGTVTASATYQRFTDAIVAKGGPRYQWRQIDPV
FT                   NNADGGAPGGNIRVGFLFNPGRVSFVDRAGGDATTPVSVVKSRGRAALSVSPGRIEPAN
FT                   EAWDASRKPLVGEFSFLGRTVFVLANHFNSKGGDQAMHGRYQEPVRSSEEQRLKQATLL
FT                   KGFVDEVKSVDRGANVVLAGDLNDYQFSPVVAKLTEGGQVVDLMSTLPANERYSYVYEG
FT                   NSQTLDHILLSSNVKRYRYDVVRINAEFADQASDHDPQVVKIRPSTGNQLLDHLVFGLE
FT                   DLADLFHRP"
     ttgagaacaa ccccgctccg cgccggttta gccgccgcag ccgccacggt cgtgtcgatc        60
     gcgtccgcga cacccgtcac cgcggctccc agccaggacg cgctcatcgc cgaggtctac       120
     ggcggcggcg ggaactccgg cgcggtgctg acccaggact tcgtcgagct ggccaaccgc       180
     gcctccgcgc cggtcgccgt cgacggctgg agcgtgcagt acctcccggc ctccgccagc       240
     gccgccagcc agtggcaggt caccccgctc accggctcga tcgcgccgaa cgcccgctac       300
     ctcgtcgccc aggccaaggg cgcaggcggc accacggcgc tgcccacccc cgacgccacc       360
     ggcgccaccg cgatggcggc gggcgcgggc acggtcgcgc tggtctccgg cacccagccg       420
     ctgacctgca agaccgccgc cgactgcgcc gccgccccag gggtcaagga cctcgtcggc       480
     tacggcacga ccgcggtcgt ccgcgagggc ggccccacgg ccaccctcac cagcaccacc       540
     tccgccgccc gcccgcagct ggtcgacagc gacgacaacg cggcggactt caccgccggc       600
     gcgcccaccc cggtcaactc caagggcgag ggcgtcggcc agaacccgga cccggacccg       660
     gatcccgacc cggacccgca gcccggtgac aagcgcatcc gcgacatcca gggcgccacc       720
     cggatctcgc cgctgctggg ccagaaggtc accggcgtcc ccggcctggt caccgcgacc       780
     cgcgccaccg gcgaccgcgg ctactggatc caggacgccc agcccgacgg cgacccccgc       840
     accagcgagg gcgtcttcgt ctacaccggc gacgcggccc cgaccgtgca gcccggcgac       900
     tccgtcctgg tcggcggcac catcgccgag taccgccccg gcggcgtcga ggcgggcaac       960
     tccaaccaga cgctcaccga gatcaccgcc ccgaccacgt cggtgctctc cagcggcaac      1020
     ccgctgcccg cgccggagag gctcgcgccc ccggccggtt acctgccgac cgcctcgggc      1080
     ggcagcatcg agcagctccc gctggagccg gacaagtacg ccctggacta cttcgagtcc      1140
     cgcgagggga tgctcgtcga ggtcgtcgac gcccgcgtca ccggcccgac caacaacttc      1200
     ggcgagacct ggatcaccac ccggccccag gacaacccga ccgcgcgcgg cggcacggtc      1260
     tacctcggct acgaccagcc caaccccggc cgcctcaagg ccaaggcggg cagcgcgacc      1320
     ccgccggtga gcgacgtcgg cgacgtctgg agcggctcca ccgtcggcaa cctggagtac      1380
     accaacttcg gcggctacac cctggccacc aagtccgtgg gcgcgcacgc gccggggggc      1440
     accaagcccg aggtgtccga cgcgaccggc aggcacgagc tgtcggtggc gacgtacaac      1500
     gtcgagaacc tggcggccac caacgaccag gccaagttcg accggctcgc cgccgcggtc      1560
     gtggcgaacc tgcgcagccc ggacgtggtg gtgctggagg agatccagga cgacaacggc      1620
     accgccaacg acggcacggt caccgcgagc gcgacctacc agcggttcac cgacgcgatc      1680
     gtcgccaagg gcggcccgcg ctaccagtgg cggcagatcg acccggtgaa caacgccgac      1740
     ggcggcgctc ccggcggcaa catccgcgtc gggttcctgt tcaaccccgg ccgggtgtcc      1800
     ttcgtggacc gcgcgggcgg cgacgccacc acgccggtct cggtcgtgaa gagccggggc      1860
     cgcgccgcgc tgtcggtgtc gcccggccgg atcgagcccg cgaacgaggc gtgggacgcg      1920
     agccgcaagc cgctggtcgg ggagttctcc ttcctgggcc gcacggtgtt cgtgctcgcc      1980
     aaccacttca actccaaggg cggcgaccag gccatgcacg gccgctacca ggagccggtc      2040
     cgctcgtccg aggagcagcg cctcaagcag gcgaccctgc tcaagggctt cgtggacgag      2100
     gtgaagtcgg tcgacagggg cgcgaacgtg gtgctcgcgg gcgacctgaa cgactaccag      2160
     ttctccccgg tggtcgcgaa gctcaccgag ggcggccagg tggtcgacct gatgtccacg      2220
     ctgcccgcga acgagcggta cagctacgtg tacgagggca actcgcagac cctcgaccac      2280
     atcctgctca gctccaacgt caagcggtac cggtacgacg tggtgcggat caacgccgag      2340
     ttcgccgacc aggccagcga tcacgacccg caggtcgtga agatcaggcc gagcaccggc      2400
     aaccagctgc tcgaccacct cgtgttcggg ctggaggacc tcgcggacct gttccaccgc      2460
     ccctga                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page