(data stored in ACNUC7421 zone)

EMBL: CP001630.PE193

CP001630.PE193       Location/Qualifiers
FT   CDS_pept        complement(208921..209328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0196"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: scl:sce5646
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34167"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF35"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACU34167.1"
FT                   /translation="MAITLVNPDGLPQVEVYRQVAIGAGAKLVFVAGQVARDGDGNRIG
FT                   EGDLAAQAEQAYLNVGTALAAAGATLGDLAKLTIYVVDWRLDLMPVLMEGVNRAFARLG
FT                   GSSLAPVTLIGVAALAEPDLLIEIEATAVVE"
     atggcgatca cgctggtgaa cccggacggg ctgccgcagg tcgaggtcta ccggcaggtg        60
     gcgatcggcg ccggggcgaa gctggtgttc gtcgccgggc aggtggcgcg cgacggcgac       120
     ggcaaccgga tcggcgaggg cgacctggcc gcgcaggccg agcaggccta cctgaacgtc       180
     ggcaccgcgc tcgccgccgc gggcgcgacg ctgggcgacc tcgccaagct gacgatctac       240
     gtcgtcgact ggcggctcga cctgatgccc gtgctcatgg agggcgtcaa ccgggcgttc       300
     gcgcggctcg gcgggagttc gctcgcgccc gtgacgctga tcggcgtcgc cgcgctggcc       360
     gagccggacc tgctgatcga gatcgaggcc accgccgtgg tcgagtag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page