(data stored in ACNUC7421 zone)

EMBL: CP001630.PE195

CP001630.PE195       Location/Qualifiers
FT   CDS_pept        complement(210404..212551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0198"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: pca:Pcar_1336 putative methyl-accepting
FT                   chemotaxis protein (MCP)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34169"
FT                   /db_xref="GOA:C6WF37"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF37"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34169.1"
FT                   /translation="MKRTRVTPLNLGLGHRLLALSIGTVIATAGVLVVVGAWQSDKFST
FT                   AAAGNVAELIQTDTDHVTSGVSTLTRTAGEAIQESVNSSMNVANAELAQRGGLRLDDSS
FT                   TTSWKAVNQLTQEATDVTLPRAEVSGAWLGQNRDQSTPTPLVDDIRSMVSATVTVFQKM
FT                   DDKGDLLRVATNVPNKAGERAIGTYIPATAQDGTPNAVAKAINSGTSYRGVAKVVDTWY
FT                   IAAYDPIKNANGDVIGALYVGIPQDKAIAQLSQAISDTTVGANGRVTVYSTAAADKGRI
FT                   IASTGGKDVGTTNADAADANGVKYVDEIVSKATSLGEGQVFNAVYQLPGLDGEPAAASP
FT                   TNVVYYGPYQWAIAVSSYGPDSAGAIEEVEQGRSAMLWAFVVAAVLIAAAAALVSLIWA
FT                   RRMTARLRGLTGALTALSERDLTVQAKVGGNDEIGEMGTALNTAVGELRELMSGISEAS
FT                   RRVEETSRNVSSTGAKLSDSASSAAEQTSNAAEAAAEVTRNVQTVAHSSTEMGSAIAEI
FT                   SRNTQAAAATAHDSVERTRQASDVIAELSAASAEITDVVRTISSIAEQTNLLALNATIE
FT                   AARAGDAGKGFAVVAGEVKDLAQETARATEDVSRRVEAINSGTTKAIESIAAITTAIDS
FT                   VNESQSAIAAAVEEQSATTDEVNRSISLASDHSSQIAVRLNQVSSTVESTRDAVRMSAD
FT                   AAEELSGTARQLTDLVGRFTL"
     atgaagcgca cacgtgtgac cccgctcaac ctggggctcg gtcaccggtt gctggcgttg        60
     agcatcggca cggtcatcgc caccgccggt gttctcgtgg tggtcggtgc ctggcagagc       120
     gacaagttca gcaccgcggc ggccggcaac gtagccgagc tgatccagac cgacaccgac       180
     cacgtcacct ccggggtgag cactctgacc cgcaccgcgg gcgaggccat ccaggagagc       240
     gtcaacagca gcatgaacgt cgcgaacgcc gagctggcgc agcgcggcgg tctgcgcctc       300
     gacgactcct ccaccacctc gtggaaggcc gtcaaccagc tcacgcagga ggccaccgac       360
     gtcaccctgc ccagggccga ggtctccggg gcctggctgg gccagaaccg cgaccagtcg       420
     accccgacgc cgctggtcga cgacatccgc tcgatggtca gcgcgaccgt caccgtcttc       480
     cagaagatgg acgacaaggg cgacctgctg cgcgtggcca ccaacgtgcc gaacaaggcg       540
     ggcgagcgcg ccatcggcac ctacatcccc gccaccgccc aggacgggac gccgaacgcg       600
     gtcgccaagg cgatcaactc gggcacctcg taccggggcg tggccaaggt cgtcgacacc       660
     tggtacatcg cggcctacga cccgatcaag aacgcgaacg gcgacgtcat cggcgcgctg       720
     tacgtgggca tcccgcagga caaggcgatc gcccagctgt cccaggccat ctcggacacc       780
     accgtgggcg ccaacggccg ggtgaccgtc tacagcaccg cggcggccga caagggccgg       840
     atcatcgcct ccaccggcgg caaggacgtc ggcacgacga acgcggacgc ggccgacgcg       900
     aacggcgtca agtacgtgga cgagatcgtc tccaaggcca cctcgctggg cgagggccag       960
     gtcttcaacg cggtctacca gctgcccggc ctcgacggcg agcccgccgc ggcctcgccg      1020
     accaacgtcg tctactacgg cccgtaccag tgggccatcg cggtctcctc gtacggcccc      1080
     gactcggcgg gcgcgatcga ggaggtcgag cagggccgca gcgcgatgct gtgggcgttc      1140
     gtggtcgccg ccgtgctgat cgccgccgcc gccgcgctgg tgtcgctgat ctgggcgcgc      1200
     cgcatgacgg cccgcctgcg cggcctgacc ggcgcgctga ccgcgctgtc cgagcgcgac      1260
     ctgaccgtcc aggcgaaggt cggcgggaac gacgagatcg gcgagatggg caccgcgctc      1320
     aacaccgccg tcggcgagct gcgcgagctg atgtccggca tctccgaggc gtccaggcgg      1380
     gtcgaggaga cctcgcggaa cgtgtcgtcg accggcgcga agctgtccga ctcggcgtcg      1440
     agcgcggcgg agcagaccag caacgccgcc gaggccgccg ccgaggtgac caggaacgtg      1500
     cagaccgtgg cgcacagctc gaccgagatg ggctccgcga tcgccgagat ctcccgcaac      1560
     acccaggccg ccgcggcgac cgcgcacgac agcgtcgagc gcacccgcca ggcgtcggac      1620
     gtcatcgccg agctgagcgc ggcgagcgcc gagatcaccg acgtggtgcg gacgatcagc      1680
     agcatcgccg agcagaccaa cctgctggcc ctgaacgcca ccatcgaggc ggcgcgggcc      1740
     ggtgacgcgg gcaagggctt cgcggtcgtc gcgggcgagg tcaaggattt ggcgcaggag      1800
     accgctcggg ccaccgagga cgtgtcgcgc cgggtcgagg cgatcaactc gggcacgacc      1860
     aaggcgatcg agtcgatcgc ggcgatcacc acggcgatcg acagcgtgaa cgagtcgcag      1920
     tcggcgatcg cggcggcggt ggaggagcag tccgccacca ccgacgaggt caaccgcagc      1980
     atcagcctgg cgtcggacca cagctcgcag atcgcggtgc ggctgaacca ggtgagctcg      2040
     accgtcgaga gcaccaggga cgccgtgcgg atgtcggcgg acgcggccga ggagctgagc      2100
     ggcaccgccc gccagctgac cgacctggtc gggcgcttca cgctctga                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page