(data stored in ACNUC7421 zone)

EMBL: CP001630.PE196

CP001630.PE196       Location/Qualifiers
FT   CDS_pept        complement(212696..214294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0199"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34170"
FT                   /db_xref="GOA:C6WF38"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF38"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34170.1"
FT                   /translation="MAVKGRALAGAPVGVKILSGVAVAVLGMVVITGVAVGQMTSLRDG
FT                   QEQLNSEAVVPLAKFDEVRRAYLQTRVDALADEWVATTNGAEHEAFTKDIKAMDAALAD
FT                   LAKSAVTDVQRSSTAELQSAWSEYIKVVASDQFLQLARTGDRAGYVAARDSQVKPQAVR
FT                   IQNALDALVQDMTTSTAAQLERASDNYATGIWVLVGTLLAAIAVAVGLAVAATRAVTGP
FT                   LRRLSEVCDALAEGDLTKRTGLTGTDEVSRVGAALDGATAKTAEAISVLSDSARSVVAA
FT                   TGKLTDTAGRISGSSADTASRADAATEAAEHVSDGVQAIATGAEEMSASIQEIARNASH
FT                   AAQLGSHARSLTEQTGATMAQLGGSSAEIGNVIKVITSIAEQTNLLALNATIEAARAGD
FT                   AGKGFAVVANEVKDLAQETARATEEISNRVEAIQADSSNAVTAIATIADVINELDGVQA
FT                   TIAAAVEEQAATTAEMSRSVADASGRTTEITGNITGVAGSAAATSDGARTTTETIGELV
FT                   AVAGDLESVVDRFRY"
     atggcagtca agggaagggc gctcgccgga gccccggtcg gggtcaagat cctctccggg        60
     gtcgcggtgg ccgtgctggg catggtcgtg atcaccggcg tcgcggtggg gcagatgacc       120
     tcgttgcgcg acggtcagga gcagctcaac agcgaggccg tggtgccgct ggccaagttc       180
     gacgaggtca ggcgcgcgta cctccagacg cgggtcgacg cgctggccga cgagtgggtc       240
     gccacgacca acggcgccga gcacgaggcg ttcaccaagg acatcaaggc gatggacgcc       300
     gccctcgccg acctggccaa gagcgccgtc accgacgtgc agcgctcgtc cacggccgag       360
     ctccagtccg cctggtccga gtacatcaag gtggtcgcca gcgaccagtt cctccagctg       420
     gcccgcaccg gtgaccgcgc cgggtacgtc gcggcgcgcg actcgcaggt caagccgcag       480
     gccgtgcgca tccagaacgc gctcgacgcg ctggtgcagg acatgacgac gtcgaccgcc       540
     gcgcagctgg agcgggcgag cgacaactac gccaccggca tctgggtgct ggtcggcacg       600
     ctgctggccg ccatcgcggt ggccgtgggc ctggccgtcg cggcgacccg cgccgtgacc       660
     ggtccgctgc gcaggctgag cgaggtgtgc gacgcgctcg ccgagggcga cctgaccaag       720
     cgcaccggcc tgaccggcac ggacgaggtc agccgggtcg gcgccgcgct cgacggcgcg       780
     accgcgaaga ccgcggaggc catctcggtg ctgtccgaca gcgcccgctc ggtggtcgcg       840
     gccaccggca agctcaccga caccgcgggc cggatctccg gctcgtcggc ggacaccgcg       900
     agccgcgccg acgcggcgac cgaggccgcc gagcacgtgt cggacggcgt gcaggccatc       960
     gccaccggcg cggaggagat gtccgcgtcc atccaggaga tcgcccgcaa cgccagccac      1020
     gccgcccagc tgggcagcca cgcccgcagc ctgaccgagc agaccggcgc gaccatggcg      1080
     cagctcggcg ggtcgtcggc ggagatcggc aacgtcatca aggtgatcac ctcgatcgcc      1140
     gagcagacca acctgctcgc cctgaacgcc accatcgagg ccgcgcgcgc cggtgacgcg      1200
     ggcaagggct tcgccgtcgt cgcgaacgag gtcaaggacc tcgcgcagga gaccgcccgc      1260
     gccaccgagg agatcagcaa ccgggtcgag gccatccagg ccgacagctc gaacgcggtg      1320
     accgcgatcg ccacgatcgc cgacgtgatc aacgagctgg acggcgtgca ggccaccatc      1380
     gcggcggccg tcgaggagca ggcggccacg accgccgaga tgagccgcag cgtcgccgac      1440
     gcgtcgggcc gcaccaccga gatcaccggc aacatcaccg gcgtcgcggg ctcggccgcc      1500
     gcgacctcgg acggggcgcg cacgaccacc gagaccatcg gcgagctggt cgccgtggcg      1560
     ggcgacctgg agtccgtggt ggaccgcttc cgctactga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page