(data stored in ACNUC7421 zone)

EMBL: CP001630.PE197

CP001630.PE197       Location/Qualifiers
FT   CDS_pept        214464..215432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0200"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   atc:AGR_pAT_447 DtxR/iron regulated lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34171"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF39"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACU34171.1"
FT                   /translation="MRLRPLVVLLALFATACGGSTDSGADTPSSASGDSAGVVTVDTRF
FT                   GPVQVEGTPKRVVALGWSDAEAALALGVQPVGVSDWMAFGGKGVGPWAESLYTETPQIL
FT                   GTMELDYEAVAALQPDLILNTRSDNDQAKHDKLSQIAPTIGAPKDVVTYGTTWQQQIEM
FT                   VGKALGKDAEAKKITEDLNAKFAANKKFDGKSAVVGSYFDGKFGAYVSGDARVDFLKAI
FT                   GFTPKAEVESLATGTFFVDVSAEQLNLFDADFTVIFPIGADTAPIKQHPVLSGIPSAKD
FT                   GRMLVMEDKTLVSAFSSGSTLGVAHALDKAVPQFQEILKVG"
     gtgcggctcc gcccgctcgt cgtcctgctc gccctgttcg ccaccgcctg cggcggttcg        60
     accgacagcg gagcggacac cccgtcgtcg gcctccggcg actccgcagg cgtcgtcacg       120
     gtcgacacca ggttcggccc cgtccaggtg gagggcaccc cgaagcgcgt cgtcgcgctc       180
     ggctggtccg acgccgaggc cgcgctggcg ctgggcgtgc agcccgtcgg cgtcagcgac       240
     tggatggcct tcggcggcaa gggcgtcggc ccgtgggccg agagcctgta caccgagacg       300
     ccccagatcc tgggcacgat ggagctggac tacgaggccg tcgcggcgct ccagcccgac       360
     ctcatcctca acacccggtc cgacaacgac caggccaagc acgacaagct gtcccagatc       420
     gcgcccacca tcggcgcgcc caaggacgtc gtcacctacg gcaccacctg gcagcagcag       480
     atcgagatgg tcggcaaggc gctgggcaag gacgccgagg ccaagaagat caccgaggac       540
     ctgaacgcga agttcgccgc gaacaagaag ttcgacggca agagcgcggt cgtcggctcc       600
     tacttcgacg gcaagttcgg cgcgtacgtc agcggcgacg ccagggtcga cttcctcaag       660
     gccatcggct tcacgcccaa ggccgaggtc gagtccctcg ccaccggcac cttcttcgtc       720
     gacgtctccg ccgagcagct caacctgttc gacgccgact tcaccgtgat cttcccgatc       780
     ggcgccgaca ccgccccgat caagcagcac cccgtgctgt cgggcatccc ctccgccaag       840
     gacggccgga tgctggtcat ggaggacaag acgctggtca gcgccttctc cagcggctcg       900
     accctgggcg tggcgcacgc gctggacaag gccgtcccgc agttccagga gatcctcaag       960
     gtgggttga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page