(data stored in ACNUC7421 zone)

EMBL: CP001630.PE198

CP001630.PE198       Location/Qualifiers
FT   CDS_pept        215613..217754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0201"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gbm:Gbem_0212 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34172"
FT                   /db_xref="GOA:C6WF40"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF40"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACU34172.1"
FT                   /translation="MVRPVALALYRKYRPATFAEVIGQEHVTDPLRIALGAGRVNHAYL
FT                   FSGPRGCGKTSSARILARSLNCAKGPTPDPCGECNSCVGLAPNGPGSVDVVELDAASHG
FT                   GVDDTRELREKAFYAPAEAKYRVFIIDEAHMVTTQGFNALLKIVEEPPEHLIFIFATTE
FT                   PDKVLPTIRSRTHHYPFRLIPPVSMRALLERNCAAEGVAVEPSVFPLVIRAGGGSARDT
FT                   QSVMDQLLSGAGPEGVRYDRAIALLGVTDVALIDDVVEGLAAGDGSAVFGTVDRLVDAG
FT                   HDPRRFATDLLDRLRDLVLLCAVPDAGERGLVSAPEDVLAKMIPQAQNIGPATLTRYAE
FT                   VLHQGLTDMRGATAPRLLLELLCARMLLPSVSDAESAVLQRVERLEKHGVAAGGGNGGG
FT                   GAPAVESKFQRPSQRQAEPEPAPAQAAPQAVAPPVAATQIAAPPVVAPPAAAQPVAAPA
FT                   EPTPQPATPQQPAAQARPTAQAAPQQARFQRPSQSPPQPASAAAEPAAPAAAPASGAVD
FT                   AVEIRRRWPELLGVVKGASRSTEAMLTNATVAEVDGTSVTLTHTSGPLARRLAEQRNAE
FT                   VIAKAFGQVLGGSWQVRCVQGDAATAQRPQQQSRQARPAPARPSQAESAPAPGHGRQML
FT                   EKAMQAQANRSTGRAGDDIPLPPEPDEPDDPLPPEPVDEEEMFAEAARPGEPGEERLDP
FT                   EAVVLKLLADELGARPLKS"
     atggtcaggc ccgtggcgct cgccctctac cgcaagtacc gaccggctac cttcgccgag        60
     gtcatcggcc aggagcacgt gaccgatccc ctgcgcatcg cgctgggcgc cgggcgggtg       120
     aaccacgcct acctcttctc cggcccgcgc ggctgcggca agacctccag cgcgcgcatc       180
     ctcgccaggt cgctgaactg cgcgaagggg cccacccccg acccgtgcgg cgagtgcaac       240
     tcctgcgtcg gcctcgcccc caacgggccc ggcagcgtcg acgtggtcga gctggacgcc       300
     gcctcgcacg gtggtgtgga cgacacccgc gagctccggg agaaggcgtt ctacgcgccc       360
     gccgaggcca agtaccgggt gttcatcatc gacgaggccc acatggtcac cacgcagggc       420
     ttcaacgccc tgctgaagat cgtggaggag cccccggagc acctgatctt catcttcgcc       480
     accaccgagc cggacaaggt gctgccgacg atccgctcgc gcacccacca ctacccgttc       540
     cggctcatcc ccccggtctc gatgcgcgcg ctgctggagc gcaactgcgc cgccgagggc       600
     gtcgcggtcg agccctcggt cttcccgctg gtcatccgcg cgggcggcgg ctccgcccgc       660
     gacacccagt ccgtcatgga ccagttgctg tccggcgcgg gccccgaggg cgtgcgctac       720
     gaccgggcca tcgcgctgct cggcgtcacc gacgtcgcgc tgatcgacga cgtggtcgag       780
     gggctcgccg ccggtgacgg ctccgccgtg ttcggcaccg tggaccggct cgtcgacgcg       840
     ggccacgacc cgcgccgctt cgccaccgac ctgctcgacc ggctgcgcga cctggtgctg       900
     ctgtgcgcgg tgcccgacgc gggcgagcgc gggctggtgt ccgcgcccga ggacgtgctg       960
     gccaagatga tcccgcaggc ccagaacatc gggcccgcca cgctcacccg gtacgccgag      1020
     gtgctgcacc aggggctcac cgacatgcgc ggggccaccg cgccccggct gctcctggag      1080
     ctgctctgcg cgcggatgct gctgccctcg gtgtcggacg ccgagtcggc ggtgctccag      1140
     cgcgtcgagc ggctggagaa gcacggcgtc gcggcgggcg gcggcaacgg cggtggcggc      1200
     gctcccgcag tcgagtccaa gttccagcgc ccctcgcagc gccaggccga gcccgaaccg      1260
     gcccccgcgc aggccgcgcc ccaggccgtg gcgcccccgg tcgccgcgac gcagatcgca      1320
     gcgcccccgg tcgtcgcacc gcctgccgcg gcgcagccgg tcgccgcgcc tgccgagccg      1380
     accccgcagc ccgccacccc gcagcagccc gccgcgcagg cccgcccgac cgcgcaggcc      1440
     gcaccgcagc aggcccggtt ccagcggccc tcccagtcgc ctccgcaacc ggcctccgcc      1500
     gccgccgaac ccgccgcgcc cgcagccgcc ccggcatccg gcgccgtcga cgcggtcgag      1560
     atccgcaggc gctggcccga gctgctcggc gtggtcaagg gggccagccg cagcaccgag      1620
     gccatgctga ccaacgccac cgtcgccgag gtcgacggca cgtcggtcac cctcacccac      1680
     acctccggcc cgctggcccg caggctcgcc gagcagcgca acgccgaggt gatcgccaag      1740
     gcgttcggcc aggtcctcgg cggcagctgg caggtccgct gcgtccaggg cgacgccgcc      1800
     accgcgcagc gcccccagca gcagtcccgc caggccaggc ccgcccccgc gcggcccagc      1860
     caggccgaga gcgcgcccgc gcccggccac ggcaggcaga tgctggagaa ggccatgcag      1920
     gcgcaggcca accggtcgac cggccgcgcg ggcgacgaca tcccgctgcc gcccgagccg      1980
     gacgagcccg acgaccccct cccaccggag ccggtggacg aggaggagat gttcgccgag      2040
     gcggccaggc cgggtgagcc gggggaggag cgcctcgacc ccgaggcggt cgtgctgaag      2100
     ctgctcgccg acgagctcgg cgcgcgcccc ttgaagagct ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page