(data stored in ACNUC7421 zone)

EMBL: CP001630.PE199

CP001630.PE199       Location/Qualifiers
FT   CDS_pept        217802..218149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gme:Gmet_3421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34173"
FT                   /db_xref="GOA:C6WF41"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF41"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACU34173.1"
FT                   /translation="MQPGQPNMQQILQQAQMMQQQLATAQQELTEAEVTGTAGGGLVRA
FT                   VVTGGGELKSLAIDPRAVDPEDVETLSDLVVAAVRDANRAAQELAAQKMGPLASGMGGL
FT                   DGLGGLGKLFG"
     gtgcaacccg gtcagcccaa catgcagcag atcctccagc aggcgcagat gatgcagcag        60
     cagctcgcca ccgcgcagca ggagctcacc gaggccgagg tcaccggcac cgcgggcggg       120
     ggcctggtcc gggccgtcgt caccggtggc ggcgagctca agagcctcgc gatcgacccc       180
     agggcggtcg accccgagga cgtggagacc ctgtccgacc tggtcgtcgc cgccgtgcgc       240
     gacgccaacc gcgcggcgca ggagctggcc gcgcagaaga tgggccccct ggccagcggc       300
     atgggcgggc tggacggcct cggcggcctc ggcaagctgt tcggctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page