(data stored in ACNUC7421 zone)

EMBL: CP001630.PE2

CP001630.PE2         Location/Qualifiers
FT   CDS_pept        2628..3764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: azc:AZC_1013 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33976"
FT                   /db_xref="GOA:C6WCF5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU33976.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDAGAEDGSGD
FT                   ALTVSGFDYEVSAQCGVPATISDGGKALVSGKLLADITKALPNHPVEINVDGARMTITC
FT                   GSAKFSLPTMPVEDYPALPSMPQLAGELPGEVFGEAVAQVAVAAGKDDTLPMLTGVRLE
FT                   IADGKLVLVATDRFRLAMREFEWTPDETLGDVAVLVPAKTLNDSAKTLGASGAKIELSL
FT                   AANDGLLGLSGNGRRTTTRLLDADFPKYRQLLPSEHSAAAIISVDTLVQAIKRVSLVAE
FT                   RGTQVRLEFGDAGLKLSAGGDDEGSAEEELPVDYQGDPVTIAFNPTYLLEGLQAVRTPR
FT                   AHLSFTTPSRPALLKPVNEDGEVAEGYVYLLMPVRLPG"
     atgaagatcc gcgtcgagcg cgacggtctg gccgacgccg tcgcctgggt cgcccgcagc        60
     ctgccgtcca ggccgcccgt cccggtcctc ggcggcgtcc tgctcgacgc gggtgcggag       120
     gacggctccg gcgacgcgct gaccgtctcc ggcttcgact acgaggtctc cgcccagtgc       180
     ggcgtcccgg ccaccatctc cgacggcggc aaggccctcg tctccggcaa gctcctggcc       240
     gacatcacca aggcgctgcc gaaccacccc gtcgagatca acgtcgacgg cgcccggatg       300
     accatcacct gcggcagcgc caagttcagc ctgccgacca tgccggtcga ggactacccg       360
     gcgctgccgt ccatgccgca gctcgcgggc gagctccccg gcgaggtctt cggcgaggcc       420
     gtcgcccagg tcgccgtcgc ggcgggcaag gacgacacgc tcccgatgct caccggcgtc       480
     cggctggaga tcgccgacgg caagctcgtc ctcgtcgcca ccgaccggtt ccggctggcc       540
     atgcgcgagt tcgagtggac ccccgacgag acgctcggcg acgtcgccgt cctcgtcccg       600
     gccaagacgc tcaacgactc cgcgaagacg ctcggcgcgt ccggcgcgaa gatcgagctg       660
     tccctcgccg ccaacgacgg cctcctcggc ctgtccggca acggccgccg caccaccacc       720
     cggctgctcg acgcggactt ccccaagtac cgccagctgc tgcccagcga gcactccgcc       780
     gccgcgatca tcagcgtcga caccctggtc caggcgatca agcgcgtgtc cctggtggcc       840
     gagcgcggca cgcaggtcag gctggagttc ggcgacgccg gcctcaagct ctcggccggt       900
     ggggacgacg aggggagcgc cgaggaggag ctgcccgtcg actaccaggg cgacccggtg       960
     acgatcgcgt tcaacccgac gtacctcctg gagggcctcc aggccgtgcg caccccgagg      1020
     gcgcacttgt cgttcaccac acccagcagg ccggcactgc tcaagcccgt gaacgaggat      1080
     ggggaggtgg cggagggcta cgtgtacctg ctcatgcccg tccgcctgcc cggctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page