(data stored in ACNUC7421 zone)

EMBL: CP001630.PE20

CP001630.PE20        Location/Qualifiers
FT   CDS_pept        20454..21095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0020"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   swi:Swit_3227 anthranilate synthase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33994"
FT                   /db_xref="GOA:C6WCH3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH3"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACU33994.1"
FT                   /translation="MRVLVVDNYDSFVYNLVQYLAQLGAECVVKRNDEVGPEDVAAAGG
FT                   VLVSPGPSTPHRAGRSMDVVRWCADSGVPVFGVCLGHQAIGAVWGATVDLAPELLHGKT
FT                   SVVHHEGAGVLAGLPRPFTATRYHSLTVLPETIPDEFEVTCRTEGGVVMGMRHRELPVE
FT                   GVQFHPESVLTDGGHRMLANWLAVCGYEVPEAVVGGLERNMRDLAAAARR"
     atgcgcgtgc tggtggtcga caactacgac agcttcgtct acaacctcgt ccagtacctg        60
     gcgcagctcg gcgccgagtg cgtggtcaag cgcaacgacg aggtcggtcc cgaggacgtc       120
     gcggcggcgg gcggggtgct ggtcagcccc ggtcccagca cgccccaccg ggccggtcgg       180
     agcatggacg tcgtgcgctg gtgcgccgac tcgggcgtcc ccgtgttcgg cgtctgcctc       240
     ggccaccagg ccatcggcgc ggtgtggggc gcgaccgtcg acctcgcgcc cgagctgctg       300
     cacggcaaga cgtcggtggt gcaccacgag ggcgcgggcg tgctcgccgg gctgccgcgg       360
     ccgttcaccg cgacccgcta ccactcgctg accgtgctgc cggagacgat ccccgacgag       420
     ttcgaggtga cctgccggac cgagggcggc gtcgtcatgg ggatgcggca ccgcgagctg       480
     cccgtcgagg gcgtccagtt ccacccggag tcggtgctca ccgacggcgg ccaccggatg       540
     ctggccaact ggctggcggt gtgcggctac gaggtgcctg aggcagtcgt gggcggcctg       600
     gagcgcaaca tgagggatct ggccgcggcg gcgcgccgct ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page