(data stored in ACNUC7421 zone)

EMBL: CP001630.PE200

CP001630.PE200       Location/Qualifiers
FT   CDS_pept        218149..218742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0203"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: mxa:MXAN_1930 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34174"
FT                   /db_xref="GOA:C6WF42"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF42"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACU34174.1"
FT                   /translation="MYEGPVQDLIDELGRLPGVGPKSAQRIAFHLLAAEPADIGRLQDA
FT                   LQKVKEGVVFCEVCGNVSAETTCRICRDPRRDLTLICVVEEPKDVLAVERTREFKGRYH
FT                   VLGGALDPLSGIGPDQLRIRQLLTRIGTDVSEIIIATDPNTEGEATATYLVRMLRDFPG
FT                   LSVTRLASGLPMGGDLEFADELTLGRALSGRRSL"
     atgtacgagg gcccggtcca ggacctgatc gacgagctcg gccgactgcc gggcgtgggt        60
     cccaagagcg cgcagcgcat cgccttccac ctgctggccg cggagcccgc ggacatcggc       120
     aggctgcagg acgccctcca gaaggtgaag gagggcgtgg tcttctgcga ggtgtgcggc       180
     aacgtctcgg ccgagacgac ctgccgcatc tgccgcgacc cgaggcgcga cctcacgctc       240
     atctgcgtgg tggaggagcc gaaggacgtc ctcgcggtcg agcggacccg cgagttcaag       300
     ggccgctacc acgtgctggg cggcgcgctc gacccgctgt ccgggatcgg gccggaccag       360
     ctgcggatca ggcagctgct caccaggatc gggaccgacg tcagcgagat catcatcgcg       420
     acggacccga acaccgaggg cgaggcgacc gccacctatc tggtgcggat gctgcgcgac       480
     ttccccggtc tgtccgtgac gcggctggcc tccggcctgc cgatgggcgg tgacctggag       540
     ttcgcggacg agctgacgct ggggcgcgcc ctgtccgggc gccggagcct ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page